C14orf104 (DNAAF2) (NM_018139) Human Tagged ORF Clone

SKU
RG212848
DNAAF2 (tGFP-tagged) - Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$966.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C14orf104
Synonyms C14orf104; CILD10; KTU; PF13
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212848 representing NM_018139
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAGCGGCGGCCTCCTCGTCGCTGGAGGACTTGGACCTGAGCGGAGAGGAGGTCCAGCGGCTCA
CCTCCGCCTTCCAGGACCCGGAGTTCCGGCGAATGTTCTCCCAGTACGCCGAGGAGCTCACCGACCCGGA
GAACCGGCGGCGCTACGAGGCGGAGATCACCGCGCTAGAGCGTGAGCGCGGGGTGGAAGTGCGGTTCGTG
CACCCGGAGCCCGGCCATGTGCTGCGCACCAGCCTGGACGGGGCGCGGCGCTGCTTTGTGAATGTCTGCA
GCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212848 representing NM_018139
Red=Cloning site Green=Tags(s)

MAKAAASSSLEDLDLSGEEVQRLTSAFQDPEFRRMFSQYAEELTDPENRRRYEAEITALERERGVEVRFV
HPEPGHVLRTSLDGARRCFVNVCS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018139
ORF Size 283 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018139.3
RefSeq Size 2976 bp
RefSeq ORF 2514 bp
Locus ID 55172
UniProt ID Q9NVR5
Cytogenetics 14q21.3
Summary This gene encodes a highly conserved protein involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:C14orf104 (DNAAF2) (NM_018139) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212848 DNAAF2 (Myc-DDK-tagged)-Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1 10 ug
$766.00
RC212848L1 Lenti ORF clone of Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1, Myc-DDK-tagged 10 ug
$1,066.00
RC212848L2 Lenti ORF clone of Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1, mGFP tagged 10 ug
$1,066.00
RC212848L3 Lenti ORF clone of Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1, Myc-DDK-tagged 10 ug
$1,066.00
RC212848L4 Lenti ORF clone of Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1, mGFP tagged 10 ug
$1,066.00
SC318322 DNAAF2 (untagged)-Human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1 10 ug
$844.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.