CXXC4 (NM_025212) Human Tagged ORF Clone

SKU
RG212834
CXXC4 (tGFP-tagged) - Human CXXC finger protein 4 (CXXC4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CXXC4
Synonyms IDAX
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212834 representing NM_025212
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCACCGAAACGACTCCCAGAGGCTGGGGAAAGCTGGCTGCCCGCCAGAGCCGTCGTTGCAAATGG
CAAATACTAATTTCCTCTCCACCTTATCCCCTGAACACTGCAGACCTTTGGCGGGGGAATGCATGAACAA
GCTCAAATGCGGCGCTGCTGAAGCAGAGATAATGAATCTCCCCGAGCGCGTGGGGACTTTTTCCGCTATC
CCGGCTTTAGGGGGCATCTCATTACCTCCAGGGGTCATCGTCATGACAGCCCTTCACTCCCCCGCAGCAG
CCTCAGCAGCCGTCACAGACAGTGCGTTTCAAATTGCCAATCTGGCAGACTGCCCGCAGAATCATTCCTC
CTCCTCCTCGTCCTCCTCAGGGGGAGCTGGCGGAGCCAACCCAGCCAAGAAGAAGAGGAAAAGGTGTGGG
GTCTGCGTGCCCTGCAAGAGGCTCATCAACTGTGGCGTCTGCAGCAGTTGCAGGAACCGCAAAACGGGAC
ACCAGATCTGCAAATTTAGAAAATGTGAAGAGCTAAAGAAAAAACCTGGCACTTCACTAGAGAGAACACC
TGTTCCCAGCGCTGAAGCATTCCGATGGTTCTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212834 representing NM_025212
Red=Cloning site Green=Tags(s)

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAI
PALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCG
VCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025212
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025212.1, NP_079488.1
RefSeq Size 761 bp
RefSeq ORF 1104 bp
Locus ID 80319
Cytogenetics 4q24
Protein Families Druggable Genome
Protein Pathways Wnt signaling pathway
Summary This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the post synaptic density protein/ Drosophila disc large tumor suppressor/ zonula occludens-1 protein domain of Dishevelled, a scaffolding protein required for the stabilization of the transcriptional co-activator beta-catenin. In addition, the CXXC domain of this protein has been shown to bind unmethylated CpG dinucleotides, localize to promoters and CpG islands, and interact with the catalytic domain of methylcytosine dioxygenase ten-eleven-translocation 2, an iron and alpha-ketoglutarate-dependent dioxygenase that modifies the methylation status of DNA. In humans, a mutation in this gene has been associated with development of malignant renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:CXXC4 (NM_025212) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212834 CXXC4 (Myc-DDK-tagged)-Human CXXC finger protein 4 (CXXC4) 10 ug
$300.00
RC212834L3 Lenti ORF clone of Human CXXC finger protein 4 (CXXC4), Myc-DDK-tagged 10 ug
$600.00
RC212834L4 Lenti ORF clone of Human CXXC finger protein 4 (CXXC4), mGFP tagged 10 ug
$600.00
SC305244 CXXC4 (untagged)-Human CXXC finger protein 4 (CXXC4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.