PLAAT2 (NM_017878) Human Tagged ORF Clone

SKU
RG212578
HRASLS2 (tGFP-tagged) - Human HRAS-like suppressor 2 (HRASLS2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PLAAT2
Synonyms HRASLS2; PLA1/2-2; PLAAT-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212578 representing NM_017878
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTGGCCAGACCAAGACCGAGACTTGGAGACCTGATTGAGATTTCTCGCTTTGGCTATGCACACT
GGGCCATCTACGTGGGAGATGGCTATGTGGTCCATCTGGCTCCGGCAAGTGAAATTGCTGGAGCTGGTGC
GGCCAGTGTCCTGTCTGCCCTGACCAACAAAGCCATAGTGAAGAAGGAACTGCTGTCTGTGGTGGCTGGG
GGAGACAACTACAGGGTCAATAACAAGCACGATGACAGATACACACCACTGCCTTCCAACAAAATCGTCA
AGCGGGCAGAGGAGTTGGTGGGGCAGGAGTTGCCTTATTCGCTGACCAGTGACAACTGCGAGCACTTCGT
GAACCATCTGCGCTATGGCGTCTCCCGCAGTGACCAGGTCACTGGTGCAGTCACGACAGTAGGTGTGGCA
GCAGGCCTGCTGGCTGCCGCAAGCCTTGTGGGGATCCTGCTGGCCAGAAGCAAGCGGGAAAGGCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212578 representing NM_017878
Red=Cloning site Green=Tags(s)

MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVAG
GDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQVTGAVTTVGVA
AGLLAAASLVGILLARSKRERQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017878
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017878.2
RefSeq Size 785 bp
RefSeq ORF 489 bp
Locus ID 54979
UniProt ID Q9NWW9
Cytogenetics 11q12.3
Protein Families Druggable Genome, Transmembrane
Summary The protein encoded by this gene has both phospholipase and acyltransferase activities and acts as a tumor suppressor. The encoded protein can hydrolyze dipalmitoylated phosphatidylcholine (PC) to palmitic acid and lyso-PC. In addition, this protein can catalyze the N-acylation of phosphatidylethanolamine and can catalyze the O-acylation of lyso-PC to form PC. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:PLAAT2 (NM_017878) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212578 HRASLS2 (Myc-DDK-tagged)-Human HRAS-like suppressor 2 (HRASLS2) 10 ug
$150.00
RC212578L1 Lenti ORF clone of Human HRAS-like suppressor 2 (HRASLS2), Myc-DDK-tagged 10 ug
$450.00
RC212578L2 Lenti ORF clone of Human HRAS-like suppressor 2 (HRASLS2), mGFP tagged 10 ug
$450.00
RC212578L3 Lenti ORF clone of Human HRAS-like suppressor 2 (HRASLS2), Myc-DDK-tagged 10 ug
$450.00
RC212578L4 Lenti ORF clone of Human HRAS-like suppressor 2 (HRASLS2), mGFP tagged 10 ug
$450.00
SC304539 HRASLS2 (untagged)-Human HRAS-like suppressor 2 (HRASLS2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.