LAT (NM_014387) Human Tagged ORF Clone

SKU
RG212439
LAT (tGFP-tagged) - Human linker for activation of T cells (LAT), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$680.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LAT
Synonyms IMD52; LAT1; pp36
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212439 representing NM_014387
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCACGGCTGCCAGCTGGCAGGTGGCTGTCCCCGTCTTGGGGGGGGCCAGCAGACCCTTGGGGC
CTAGGGGTGCAGCCAGCCTGCTCCGAGCTCCCCTGCAGATGGAGGAGGCCATCCTGGTCCCCTGCGTGCT
GGGGCTCCTGCTGCTGCCCATCCTGGCCATGTTGATGGCACTGTGTGTGCACTGCCACAGACTGCCAGGC
TCCTACGACAGCACATCCTCAGATAGTTTGTATCCAAGGGGCATCCAGTTCAAACGGCCTCACACGGTTG
CCCCCTGGCCACCTGCCTACCCACCTGTCACCTCCTACCCACCCCTGAGCCAGCCAGACCTGCTCCCCAT
CCCAAGATCCCCGCAGCCCCTTGGGGGCTCCCACCGGACGCCATCTTCCCGGCGGGATTCTGATGGTGCC
AACAGTGTGGCGAGCTACGAGAACGAGGAACCAGCCTGTGAGGATGCGGATGAGGATGAGGACGACTATC
ACAACCCAGGCTACCTGGTGGTGCTTCCTGACAGCACCCCGGCCACTAGCACTGCTGCCCCATCAGCTCC
TGCACTCAGCACCCCTGGCATCCGAGACAGTGCCTTCTCCATGGAGTCCATTGATGATTACGTGAACGTT
CCGGAGAGCGGGGAGAGCGCAGAAGCGTCTCTGGATGGCAGCCGGGAGTATGTGAATGTGTCCCAGGAAC
TGCATCCTGGAGCGGCTAAGACTGAGCCTGCCGCCCTGAGTTCCCAGGAGGCAGAGGAAGTGGAGGAAGA
GGGGGCTCCAGATTACGAGAATCTGCAGGAGCTGAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212439 representing NM_014387
Red=Cloning site Green=Tags(s)

MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQMEEAILVPCVLGLLLLPILAMLMALCVHCHRLPG
SYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGA
NSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNV
PESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014387
ORF Size 807 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014387.3, NP_055202.1
RefSeq Size 1767 bp
RefSeq ORF 789 bp
Locus ID 27040
UniProt ID O43561
Cytogenetics 16p11.2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Summary The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site for SH2 domain-containing proteins. Upon phosphorylation, this protein recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LAT (NM_014387) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212439 LAT (Myc-DDK-tagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$480.00
RC212439L1 Lenti-ORF clone of LAT (Myc-DDK-tagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$780.00
RC212439L2 Lenti-ORF clone of LAT (mGFP-tagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$780.00
RC212439L3 Lenti-ORF clone of LAT (Myc-DDK-tagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$780.00
RC212439L4 Lenti-ORF clone of LAT (mGFP-tagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$780.00
SC122805 LAT (untagged)-Human linker for activation of T cells (LAT), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.