HRK (NM_003806) Human Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
RG212069
HRK (tGFP-tagged) - Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK)
$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HRK
Synonyms DP5; HARAKIRI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212069 representing NM_003806
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCCGTGCCCCCTGCACCGCGGCCGCGGCCCCCCGGCCGTGTGCGCCTGCAGCGCGGGTCGCCTGG
GGCTGCGCTCGTCCGCCGCGCAGCTCACCGCCGCCCGGCTCAAGGCGCTAGGCGACGAGCTGCACCAGCG
CACCATGTGGCGGCGCCGCGCGCGGAGCCGGAGGGCGCCGGCGCCCGGCGCGCTCCCCACCTACTGGCCT
TGGCTGTGCGCGGCCGCGCAGGTGGCGGCGCTGGCGGCCTGGCTGCTCGGCAGGCGGAACTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212069 representing NM_003806
Red=Cloning site Green=Tags(s)

MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP
WLCAAAQVAALAAWLLGRRNL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003806
ORF Size 273 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003806.4
RefSeq Size 716 bp
RefSeq ORF 276 bp
Locus ID 8739
UniProt ID O00198
Cytogenetics 12q24.22
Protein Families Druggable Genome, Transmembrane
Summary This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC212069 HRK (Myc-DDK-tagged)-Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK) 10 ug
$150.00
RC212069L1 Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), Myc-DDK-tagged 10 ug
$450.00
RC212069L2 Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), mGFP tagged 10 ug
$450.00
RC212069L3 Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), Myc-DDK-tagged 10 ug
$450.00
RC212069L4 Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), mGFP tagged 10 ug
$450.00
SC303381 HRK (untagged)-Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.