Prostate Specific Antigen (KLK3) (NM_001030050) Human Tagged ORF Clone

SKU
RG211729
KLK3 (tGFP-tagged) - Human kallikrein-related peptidase 3 (KLK3), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Prostate Specific Antigen
Synonyms APS; hK3; KLK2A1; PSA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG211729 representing NM_001030050
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGTCCCGGTTGTCTTCCTCACCCTGTCCGTGACGTGGATTGGTGCTGCACCCCTCATCCTGTCTC
GGATTGTGGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTGCTTGTGGCCTCTCGTGGCAG
GGCAGTCTGCGGCGGTGTTCTGGTGCACCCCCAGTGGGTCCTCACAGCTGCCCACTGCATCAGGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211729 representing NM_001030050
Red=Cloning site Green=Tags(s)

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001030050
ORF Size 207 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001030050.1, NP_001025221.1
RefSeq Size 555 bp
RefSeq ORF 209 bp
Locus ID 354
Cytogenetics 19q13.33
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Pathways in cancer, Prostate cancer
Summary Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Dec 2019]
Write Your Own Review
You're reviewing:Prostate Specific Antigen (KLK3) (NM_001030050) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211729 KLK3 (Myc-DDK-tagged)-Human kallikrein-related peptidase 3 (KLK3), transcript variant 6 10 ug
$165.00
RC211729L3 Lenti-ORF clone of KLK3 (Myc-DDK-tagged)-Human kallikrein-related peptidase 3 (KLK3), transcript variant 6 10 ug
$465.00
RC211729L4 Lenti-ORF clone of KLK3 (mGFP-tagged)-Human kallikrein-related peptidase 3 (KLK3), transcript variant 6 10 ug
$465.00
SC302501 KLK3 (untagged)-Human kallikrein-related peptidase 3 (KLK3), transcript variant 6 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.