TPSD1 (NM_012217) Human Tagged ORF Clone

SKU
RG211637
TPSD1 (tGFP-tagged) - Human tryptase delta 1 (TPSD1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TPSD1
Synonyms MCP7-LIKE; MCP7L1; MMCP-7L
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG211637 representing NM_012217
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCTCCTTGCTCCCCAGATGCTGAGCCTGCTGCTGCTGGCGCTGCCCGTCCTGGCGAGCCCGGCCT
ACGTGGCCCCTGCCCCAGGCCAGGCCCTGCAGCAAACGGGCATTGTTGGGGGGCAGGAGGCCCCCAGGAG
CAAGTGGCCCTGGCAGGTGAGCCTGAGAGTCCGCGGCCCATACTGGATGCACTTCTGCGGGGGCTCCCTC
ATCCACCCCCAGTGGGTGCTAACCGCGGCGCACTGCGTGGAACCGGACATCAAGGATCTGGCCGCCCTCA
GGGTGCAACTGCGGGAGCAGCACCTCTACTACCAGGACCAGCTGCTGCCGGTCAGCAGGATCATCGTGCA
CCCACAGTTCTACATCATCCAGACCGGGGCGGACATCGCCCTGCTGGAGCTGGAGGAGCCCGTGAACATC
TCCAGCCACATCCACACGGTCACGCTGCCCCCTGCCTCGGAGACCTTCCCCCCGGGGATGCCGTGCTGGG
TCACTGGCTGGGGCGACGTGGACAATAATGTGCACCTGCCGCCGCCATACCCGCTGAAGGAGGTGGAAGT
CCCCGTAGTGGAAAACCACCTTTGCAACGCGGAATATCACACCGGCCTCCATACGGGCCACAGCTTTCAA
ATCGTCCGCGATGACATGCTGTGTGCGGGGAGCGAAAATCACGACTCCTGCCAGGGTGACTCTGGAGGGC
CCCTGGTCTGCAAGGTGAATGGCACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211637 representing NM_012217
Red=Cloning site Green=Tags(s)

MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL
IHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNI
SSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ
IVRDDMLCAGSENHDSCQGDSGGPLVCKVNGT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012217
ORF Size 726 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012217.3
RefSeq Size 855 bp
RefSeq ORF 729 bp
Locus ID 23430
UniProt ID Q9BZJ3
Cytogenetics 16p13.3
Protein Families Druggable Genome, Protease, Secreted Protein
Summary Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. Although this gene may be an exception, most of the tryptase genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. This gene was once considered to be a pseudogene, although it is now believed to be a functional gene that encodes a protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TPSD1 (NM_012217) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211637 TPSD1 (Myc-DDK-tagged)-Human tryptase delta 1 (TPSD1) 10 ug
$300.00
RC211637L3 Lenti ORF clone of Human tryptase delta 1 (TPSD1), Myc-DDK-tagged 10 ug
$600.00
RC211637L4 Lenti ORF clone of Human tryptase delta 1 (TPSD1), mGFP tagged 10 ug
$600.00
SC125593 TPSD1 (untagged)-Human tryptase delta 1 (TPSD1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.