GNG13 (NM_016541) Human Tagged ORF Clone

SKU
RG210828
GNG13 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNG13
Synonyms G(gamma)13; h2-35
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210828 representing NM_016541
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGTGGGACGTGCCACAGATGAAGAAAGAGGTGGAGAGCCTCAAGTACCAGCTGGCCTTCCAGC
GGGAGATGGCGTCCAAGACCATCCCCGAGCTGCTGAAGTGGATCGAGGACGGGATCCCCAAGGACCCCTT
CCTGAACCCCGACCTGATGAAGAACAACCCATGGGTGGAAAAGGGCAAATGCACCATCCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210828 representing NM_016541
Red=Cloning site Green=Tags(s)

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016541
ORF Size 201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016541.3
RefSeq Size 980 bp
RefSeq ORF 204 bp
Locus ID 51764
UniProt ID Q9P2W3
Cytogenetics 16p13.3
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Taste transduction
Summary Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009]
Write Your Own Review
You're reviewing:GNG13 (NM_016541) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210828 GNG13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13) 10 ug
$150.00
RC210828L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), Myc-DDK-tagged 10 ug
$450.00
RC210828L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), mGFP tagged 10 ug
$450.00
RC210828L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), Myc-DDK-tagged 10 ug
$450.00
RC210828L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), mGFP tagged 10 ug
$450.00
SC125264 GNG13 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.