COX19 (NM_001031617) Human Tagged ORF Clone

SKU
RG210770
COX19 (tGFP-tagged) - Human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210770 representing NM_001031617
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGACCGCCATGAATTTCGGGACCAAGAGCTTCCAGCCGCGGCCCCCGGACAAGGGCAGCTTCCCGC
TGGATCACTTAGGTGAATGTAAAAGCTTTAAAGAGAAATTCATGAAGTGTCTTCATAACAATAATTTTGA
AAATGCTTTGTGCAGAAAGGAATCAAAAGAATATTTAGAATGCAGGATGGAGAGAAAATTGATGCTACAA
GAACCATTGGAGAAACTGGGATTTGGAGACTTGACTAGTGGAAAATCAGAGGCAAAAAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210770 representing NM_001031617
Red=Cloning site Green=Tags(s)

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ
EPLEKLGFGDLTSGKSEAKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001031617
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001031617.3
RefSeq Size 4896 bp
RefSeq ORF 273 bp
Locus ID 90639
UniProt ID Q49B96
Cytogenetics 7p22.3
Summary COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:COX19 (NM_001031617) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210770 COX19 (Myc-DDK-tagged)-Human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) 10 ug
$150.00
RC210770L3 Lenti ORF clone of Human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19), Myc-DDK-tagged 10 ug
$450.00
RC210770L4 Lenti ORF clone of Human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19), mGFP tagged 10 ug
$450.00
SC302518 COX19 (untagged)-Human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.