Serum Amyloid A (SAA1) (NM_000331) Human Tagged ORF Clone

SKU
RG210664
SAA1 (tGFP-tagged) - Human serum amyloid A1 (SAA1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Serum Amyloid A
Synonyms PIG4; SAA; SAA2; TP53I4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210664 representing NM_000331
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGCTTCTTTTCGT
TCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCTGACATGAGAGAAGCCAATTA
CATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCAAAAGGGGACCTGGGGGTGTC
TGGGCTGCAGAAGCGATCAGCGATGCCAGAGAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACT
CGCTGGCTGATCAGGCTGCCAATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGG
CCTGCCTGAGAAATAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210664 representing NM_000331
Red=Cloning site Green=Tags(s)

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000331
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000331.1
RefSeq Size 722 bp
RefSeq ORF 369 bp
Locus ID 6288
UniProt ID P02735
Cytogenetics 11p15.1
Summary This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]
Write Your Own Review
You're reviewing:Serum Amyloid A (SAA1) (NM_000331) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210664 SAA1 (Myc-DDK-tagged)-Human serum amyloid A1 (SAA1), transcript variant 1 10 ug
$150.00
RC210664L1 Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC210664L2 Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC210664L3 Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC210664L4 Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC300047 SAA1 (untagged)-Human serum amyloid A1 (SAA1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.