G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone

SKU
RG210610
MLST8 (tGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol G protein beta subunit like
Synonyms GbetaL; GBL; LST8; POP3; WAT1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210610 representing NM_022372
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACACCTCCCCAGGCACGGTGGGCAGTGACCCGGTCATCCTGGCCACTGCAGGCTACGACCACACCG
TGCGCTTCTGGCAGGCCCACAGCGGCATCTGCACCCGGACGGTGCAGCACCAGGACTCCCAGGTGAATGC
CTTGGAGGTCACACCGGACCGCAGCATGATTGCTGCTGCAGGTTACCAGCACATCCGCATGTATGATCTC
AACTCCAATAACCCTAACCCCATCATCAGCTACGACGGCGTCAACAAGAACATCGCGTCTGTGGGCTTCC
ACGAAGACGGCCGCTGGATGTACACGGGCGGCGAGGACTGCACAGCCAGGATCTGGGACCTCAGGTCCCG
GAACCTGCAGTGCCAGCGGATCTTCCAGGTGAACGCACCCATTAACTGCGTGTGCCTGCACCCCAACCAG
GCAGAGCTCATCGTGGGTGACCAGAGCGGGGCTATCCACATCTGGGACTTGAAAACAGACCACAACGAGC
AGCTGATCCCTGAGCCCGAGGTCTCCATCACGTCCGCCCACATCGATCCCGACGCCAGCTACATGGCAGC
TGTCAATAGCACCGGAAACTGCTATGTCTGGAATCTGACGGGGGGCATTGGTGACGAGGTGACCCAGCTC
ATCCCCAAGACTAAGATCCCTGCCCACACGCGCTACGCCCTGCAGTGTCGCTTCAGCCCCGACTCCACGC
TCCTCGCCACCTGCTCGGCTGATCAGACGTGCAAGATCTGGAGGACGTCCAACTTCTCCCTGATGACGGA
GCTGAGCATCAAGAGCGGCAACCCCGGGGAGTCCTCCCGCGGCTGGATGTGGGGCTGCGCCTTCTCGGGG
GACTCCCAGTACATCGTCACTGCTTCCTCGGACAACCTGGCCCGGCTCTGGTGTGTGGAGACTGGAGAGA
TCAAGAGAGAGTATGGCGGCCACCAGAAGGCTGTTGTCTGCCTGGCCTTCAATGACAGTGTGCTGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210610 representing NM_022372
Red=Cloning site Green=Tags(s)

MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDL
NSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQ
AELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQL
IPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSG
DSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022372
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022372.6
RefSeq Size 1655 bp
RefSeq ORF 981 bp
Locus ID 64223
UniProt ID Q9BVC4
Cytogenetics 16p13.3
Domains WD40
Protein Pathways mTOR signaling pathway
Summary Subunit of both mTORC1 and mTORC2, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, LST8 interacts directly with MTOR and enhances its kinase activity. In nutrient-poor conditions, stabilizes the MTOR-RPTOR interaction and favors RPTOR-mediated inhibition of MTOR activity. mTORC2 is also activated by growth factors, but seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210610 MLST8 (Myc-DDK-tagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1 10 ug
$300.00
RC210610L1 Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210610L2 Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210610L3 Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210610L4 Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged 10 ug
$600.00
SC127163 MLST8 (untagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.