DNAJC15 (NM_013238) Human Tagged ORF Clone

SKU
RG210567
DNAJC15 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJC15
Synonyms DNAJD1; HSD18; MCJ
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210567 representing NM_013238
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCCGTGGTGTCATCGCTCCAGTTGGCGAGAGTTTGCGCTACGCTGAGTACTTGCAGCCCTCGG
CCAAACGGCCAGACGCCGACGTCGACCAGCAGAGACTGGTAAGAAGTTTGATAGCTGTAGGCCTGGGTGT
TGCAGCTCTTGCATTTGCAGGTCGCTACGCATTTCGGATCTGGAAACCTCTAGAACAAGTTATCACAGAA
ACTGCAAAGAAGATTTCAACTCCTAGCTTTTCATCCTACTATAAAGGAGGATTTGAACAGAAAATGAGTA
GGCGAGAAGCTGGTCTTATTTTAGGTGTAAGCCCATCTGCTGGCAAGGCTAAGATTAGAACAGCTCATAG
GAGAGTCATGATTTTGAATCACCCAGATAAAGGTGGATCTCCTTACGTAGCAGCCAAAATAAATGAAGCA
AAAGACTTGCTAGAAACAACCACCAAACAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210567 representing NM_013238
Red=Cloning site Green=Tags(s)

MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITE
TAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEA
KDLLETTTKH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013238
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013238.2, NP_037370.2
RefSeq Size 2792 bp
RefSeq ORF 453 bp
Locus ID 29103
UniProt ID Q9Y5T4
Cytogenetics 13q14.11
Domains DnaJ
Protein Families Transmembrane
Summary Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DNAJC15 (NM_013238) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210567 DNAJC15 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15) 10 ug
$150.00
RC210567L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15), Myc-DDK-tagged 10 ug
$450.00
RC210567L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15), mGFP tagged 10 ug
$450.00
RC210567L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15), Myc-DDK-tagged 10 ug
$450.00
RC210567L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15), mGFP tagged 10 ug
$450.00
SC115339 DNAJC15 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.