Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Tagged ORF Clone

SKU
RG210481
CCL4 (tGFP-tagged) - Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Macrophage Inflammatory Protein 1 beta
Synonyms ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210481 representing NM_002984
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCTGCGTGACTGTCCTGTCTCTCCTCATGCTAGTAGCTGCCTTCTGCTCTCCAGCGCTCTCAG
CACCAATGGGCTCAGACCCTCCCACCGCCTGCTGCTTTTCTTACACCGCGAGGAAGCTTCCTCGCAACTT
TGTGGTAGATTACTATGAGACCAGCAGCCTCTGCTCCCAGCCAGCTGTGGTATTCCAAACCAAAAGAAGC
AAGCAAGTCTGTGCTGATCCCAGTGAATCCTGGGTCCAGGAGTACGTGTATGACCTGGAACTGAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210481 representing NM_002984
Red=Cloning site Green=Tags(s)

MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS
KQVCADPSESWVQEYVYDLELN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002984
ORF Size 276 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002984.4
RefSeq Size 667 bp
RefSeq ORF 279 bp
Locus ID 6351
UniProt ID P13236
Cytogenetics 17q12
Domains IL8
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Toll-like receptor signaling pathway
Summary The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210481 CCL4 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1 10 ug
$225.00
RC210481L1 Lenti ORF clone of Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC210481L2 Lenti ORF clone of Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, mGFP tagged 10 ug
$525.00
RC210481L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, Myc-DDK-tagged 10 ug
$525.00
RC210481L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, mGFP tagged 10 ug
$525.00
SC118320 CCL4 (untagged)-Human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.