LBH (NM_030915) Human Tagged ORF Clone

SKU
RG210467
LBH (tGFP-tagged) - Human limb bud and heart development homolog (mouse) (LBH)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LBH
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210467 representing NM_030915
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTATATATTTCCCCATTCACTGCCCCGACTATCTGAGATCGGCCAAGATGACTGAGGTGATGATGA
ACACCCAGCCCATGGAGGAGATCGGCCTCAGCCCCCGCAAGGATGGCCTTTCCTACCAGATCTTCCCAGA
CCCGTCAGATTTTGACCGCTGCTGCAAACTGAAGGACCGTCTGCCCTCCATAGTGGTGGAACCCACAGAA
GGGGAGGTGGAGAGCGGGGAGCTCCGGTGGCCCCCTGAGGAGTTCCTGGTCCAGGAGGATGAGCAAGATA
ACTGCGAAGAGACAGCGAAAGAAAATAAAGAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210467 representing NM_030915
Red=Cloning site Green=Tags(s)

MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE
GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030915
ORF Size 315 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030915.4
RefSeq Size 2955 bp
RefSeq ORF 318 bp
Locus ID 81606
UniProt ID Q53QV2
Cytogenetics 2p23.1
Summary Transcriptional activator which may act in mitogen-activated protein kinase signaling pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LBH (NM_030915) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210467 LBH (Myc-DDK-tagged)-Human limb bud and heart development homolog (mouse) (LBH) 10 ug
$150.00
RC210467L1 Lenti ORF clone of Human limb bud and heart development homolog (mouse) (LBH), Myc-DDK-tagged 10 ug
$450.00
RC210467L2 Lenti ORF clone of Human limb bud and heart development homolog (mouse) (LBH), mGFP tagged 10 ug
$450.00
RC210467L3 Lenti ORF clone of Human limb bud and heart development homolog (mouse) (LBH), Myc-DDK-tagged 10 ug
$450.00
RC210467L4 Lenti ORF clone of Human limb bud and heart development homolog (mouse) (LBH), mGFP tagged 10 ug
$450.00
SC109114 LBH (untagged)-Human limb bud and heart development homolog (mouse) (LBH) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.