Ephrin A5 (EFNA5) (NM_001962) Human Tagged ORF Clone

SKU
RG210411
EFNA5 (tGFP-tagged) - Human ephrin-A5 (EFNA5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ephrin A5
Synonyms AF1; EFL5; EPLG7; GLC1M; LERK7; RAGS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210411 representing NM_001962
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCACGTGGAGATGTTGACGCTGGTGTTTCTGGTGCTCTGGATGTGTGTGTTCAGCCAGGACCCGG
GCTCCAAGGCCGTCGCCGACCGCTACGCTGTCTACTGGAACAGCAGCAACCCCAGATTCCAGAGGGGTGA
CTACCATATTGATGTCTGTATCAATGACTACCTGGATGTTTTCTGCCCTCACTATGAGGACTCCGTCCCA
GAAGATAAGACTGAGCGCTATGTCCTCTACATGGTGAACTTTGATGGCTACAGTGCCTGCGACCACACTT
CCAAAGGGTTCAAGAGATGGGAATGTAACCGGCCTCACTCTCCAAATGGACCGCTGAAGTTCTCTGAAAA
ATTCCAGCTCTTCACTCCCTTTTCTCTAGGATTTGAATTCAGGCCAGGCCGAGAATATTTCTACATCTCC
TCTGCAATCCCAGATAATGGAAGAAGGTCCTGTCTAAAGCTCAAAGTCTTTGTGAGACCAACAAATAGCT
GTATGAAAACTATAGGTGTTCATGATCGTGTTTTCGATGTTAACGACAAAGTAGAAAATTCATTAGAACC
AGCAGATGACACCGTACATGAGTCAGCCGAGCCATCCCGCGGCGAGAACGCGGCACAAACACCAAGGATA
CCCAGCCGCCTTTTGGCAATCCTACTGTTCCTCCTGGCGATGCTTTTGACATTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210411 representing NM_001962
Red=Cloning site Green=Tags(s)

MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP
EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIS
SAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRI
PSRLLAILLFLLAMLLTL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001962
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001962.3
RefSeq Size 1574 bp
RefSeq ORF 687 bp
Locus ID 1946
UniProt ID P52803
Cytogenetics 5q21.3
Protein Families Druggable Genome
Protein Pathways Axon guidance
Summary Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Ephrin A5 (EFNA5) (NM_001962) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210411 EFNA5 (Myc-DDK-tagged)-Human ephrin-A5 (EFNA5) 10 ug
$300.00
RC210411L1 Lenti ORF clone of Human ephrin-A5 (EFNA5), Myc-DDK-tagged 10 ug
$600.00
RC210411L2 Lenti ORF clone of Human ephrin-A5 (EFNA5), mGFP tagged 10 ug
$600.00
RC210411L3 Lenti ORF clone of Human ephrin-A5 (EFNA5), Myc-DDK-tagged 10 ug
$600.00
RC210411L4 Lenti ORF clone of Human ephrin-A5 (EFNA5), mGFP tagged 10 ug
$600.00
SC303099 EFNA5 (untagged)-Human ephrin-A5 (EFNA5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.