FABP2 (NM_000134) Human Tagged ORF Clone

SKU
RG210206
FABP2 (tGFP-tagged) - Human fatty acid binding protein 2, intestinal (FABP2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FABP2
Synonyms FABPI; I-FABP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210206 representing NM_000134
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTG
TTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAA
ATTCACAGTCAAAGAATCAAGCGCTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAAT
TACAACCTAGCAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAAT
TCAAACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGAC
TTATGTGTATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210206 representing NM_000134
Red=Cloning site Green=Tags(s)

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN
YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000134
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000134.2, NP_000125.1
RefSeq Size 2273 bp
RefSeq ORF 399 bp
Locus ID 2169
UniProt ID P12104
Cytogenetics 4q26
Protein Pathways PPAR signaling pathway
Summary The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:FABP2 (NM_000134) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210206 FABP2 (Myc-DDK-tagged)-Human fatty acid binding protein 2, intestinal (FABP2) 10 ug
$150.00
RC210206L3 Lenti ORF clone of Human fatty acid binding protein 2, intestinal (FABP2), Myc-DDK-tagged 10 ug
$450.00
RC210206L4 Lenti ORF clone of Human fatty acid binding protein 2, intestinal (FABP2), mGFP tagged 10 ug
$450.00
SC300013 FABP2 (untagged)-Human fatty acid binding protein 2, intestinal (FABP2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.