CCL3 (NM_002983) Human Tagged ORF Clone

SKU
RG210026
CCL3 (tGFP-tagged) - Human chemokine (C-C motif) ligand 3 (CCL3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCL3
Synonyms G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210026 representing NM_002983
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAGTCTCCACTGCTGCCCTTGCTGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGTTCTCTGCAT
CACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGGCAGATTCCACAGAATTTCAT
AGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCTGGTGTCATCTTCCTAACCAAGCGAAGCCGG
CAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATATGTCAGCGACCTGGAGCTGAGTGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210026 representing NM_002983
Red=Cloning site Green=Tags(s)

MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR
QVCADPSEEWVQKYVSDLELSA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002983
ORF Size 276 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002983.1, NP_002974.1
RefSeq Size 776 bp
RefSeq ORF 279 bp
Locus ID 6348
UniProt ID P10147
Cytogenetics 17q12
Domains IL8
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway
Summary This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]
Write Your Own Review
You're reviewing:CCL3 (NM_002983) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210026 CCL3 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 3 (CCL3) 10 ug
$225.00
RC210026L1 Lenti ORF clone of Human chemokine (C-C motif) ligand 3 (CCL3), Myc-DDK-tagged 10 ug
$525.00
RC210026L2 Lenti ORF clone of Human chemokine (C-C motif) ligand 3 (CCL3), mGFP tagged 10 ug
$525.00
RC210026L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 3 (CCL3), Myc-DDK-tagged 10 ug
$525.00
RC210026L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 3 (CCL3), mGFP tagged 10 ug
$525.00
SC118318 CCL3 (untagged)-Human chemokine (C-C motif) ligand 3 (CCL3) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.