DNAJC19 (NM_145261) Human Tagged ORF Clone

SKU
RG209910
DNAJC19 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJC19
Synonyms PAM18; TIM14; TIMM14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209910 representing NM_145261
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGTACAGTGGTAGCAGTTGGACTGACCATTGCTGCTGCAGGATTTGCAGGCCGTTACGTTTTGC
AAGCCATGAAGCATATGGAGCCTCAAGTAAAACAAGTTTTTCAAAGCCTACCAAAATCTGCCTTCAGTGG
TGGCTATTATAGAGGTGGGTTTGAACCCAAAATGACAAAACGGGAAGCAGCATTAATACTAGGTGTAAGC
CCTACTGCCAATAAAGGGAAAATAAGAGATGCTCATCGACGAATTATGCTTTTAAATCATCCTGACAAAG
GAGGATCTCCTTATATAGCAGCCAAAATCAATGAAGCTAAAGATTTACTAGAAGGTCAAGCTAAAAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209910 representing NM_145261
Red=Cloning site Green=Tags(s)

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS
PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145261
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145261.4
RefSeq Size 1431 bp
RefSeq ORF 351 bp
Locus ID 131118
UniProt ID Q96DA6
Cytogenetics 3q26.33
Domains DnaJ
Protein Families Transmembrane
Summary The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:DNAJC19 (NM_145261) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209910 DNAJC19 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), transcript variant 1 10 ug
$150.00
RC209910L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC209910L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), transcript variant 1, mGFP tagged 10 ug
$450.00
SC100134 DNAJC19 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.