SNRPD1 (NM_006938) Human Tagged ORF Clone

SKU
RG209902
SNRPD1 (tGFP-tagged) - Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNRPD1
Synonyms HsT2456; Sm-D1; SMD1; SNRPD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209902 representing NM_006938
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCGTGAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAACGGAACAC
AGGTCCATGGAACAATCACAGGTGTGGATGTCAGCATGAATACACATCTTAAAGCTGTGAAAATGACCCT
GAAGAACAGAGAACCTGTACAGCTGGAAACGCTGAGTATTCGAGGAAATAACATTCGGTATTTTATTCTA
CCAGACAGTTTACCTCTGGATACACTACTTGTGGATGTTGAACCTAAGGTGAAATCTAAGAAAAGGGAAG
CTGTTGCAGGAAGAGGCAGAGGAAGAGGAAGAGGAAGAGGACGTGGCCGTGGCAGAGGAAGAGGGGGTCC
TAGGCGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209902 representing NM_006938
Red=Cloning site Green=Tags(s)

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006938
ORF Size 357 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006938.4
RefSeq Size 1614 bp
RefSeq ORF 360 bp
Locus ID 6632
UniProt ID P62314
Cytogenetics 18q11.2
Domains Sm
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Spliceosome, Systemic lupus erythematosus
Summary This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:SNRPD1 (NM_006938) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209902 SNRPD1 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1) 10 ug
$225.00
RC209902L3 Lenti-ORF clone of SNRPD1 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1) 10 ug
$525.00
RC209902L4 Lenti-ORF clone of SNRPD1 (mGFP-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1) 10 ug
$525.00
SC115794 SNRPD1 (untagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.