Galectin 7 (LGALS7B) (NM_001042507) Human Tagged ORF Clone

SKU
RG209569
LGALS7B (tGFP-tagged) - Human lectin, galactoside-binding, soluble, 7B (LGALS7B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Galectin 7
Synonyms Gal-7; GAL7; HKL-14; LGALS7; PI7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209569 representing NM_001042507
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAACGTCCCCCACAAGTCCTCGCTGCCCGAGGGCATCCGCCCTGGCACGGTGCTGAGAATTCGCG
GCTTGGTTCCTCCCAATGCCAGCAGGTTCCATGTAAACCTGCTGTGCGGGGAGGAGCAGGGCTCCGATGC
CGCCCTGCATTTCAACCCCCGGCTGGACACGTCGGAGGTGGTCTTCAACAGCAAGGAGCAAGGCTCCTGG
GGCCGCGAGGAGCGCGGGCCGGGCGTTCCTTTCCAGCGCGGGCAGCCCTTCGAGGTGCTCATCATCGCGT
CAGACGACGGCTTCAAGGCCGTGGTTGGGGACGCCCAGTACCACCACTTCCGCCACCGCCTGCCGCTGGC
GCGCGTGCGCCTGGTGGAGGTGGGCGGGGACGTGCAGCTGGACTCCGTGAGGATCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209569 representing NM_001042507
Red=Cloning site Green=Tags(s)

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW
GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001042507
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001042507.1, NP_001035972.1
RefSeq Size 411 bp
RefSeq ORF 411 bp
Locus ID 653499
UniProt ID P47929
Cytogenetics 19q13.2
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Galectin 7 (LGALS7B) (NM_001042507) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209569 LGALS7B (Myc-DDK-tagged)-Human lectin, galactoside-binding, soluble, 7B (LGALS7B) 10 ug
$150.00
RC209569L3 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 7B (LGALS7B), Myc-DDK-tagged 10 ug
$450.00
RC209569L4 Lenti ORF clone of Human lectin, galactoside-binding, soluble, 7B (LGALS7B), mGFP tagged 10 ug
$450.00
SC311221 LGALS7B (untagged)-Human lectin, galactoside-binding, soluble, 7B (LGALS7B) 10 ug
$150.00
SC322732 LGALS7B (untagged)-Human lectin, galactoside-binding, soluble, 7B (LGALS7B) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.