SCN1B (NM_001037) Human Tagged ORF Clone

SKU
RG209565
SCN1B (tGFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCN1B
Synonyms ATFB13; BRGDA5; DEE52; EIEE52; GEFSP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209565 representing NM_001037
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGGCTGCTGGCCTTAGTGGTCGGCGCGGCACTGGTGTCCTCAGCCTGCGGGGGCTGCGTGGAGG
TGGACTCGGAGACCGAGGCCGTGTATGGGATGACCTTCAAAATTCTTTGCATCTCCTGCAAGCGCCGCAG
CGAGACCAACGCTGAGACCTTCACCGAGTGGACCTTCCGCCAGAAGGGCACTGAGGAGTTTGTCAAGATC
CTGCGCTATGAGAATGAGGTGTTGCAGCTGGAGGAGGATGAGCGCTTCGAGGGCCGCGTGGTGTGGAATG
GCAGCCGGGGCACCAAAGACCTGCAGGATCTGTCTATCTTCATCACCAATGTCACCTACAACCACTCGGG
CGACTACGAGTGCCACGTCTACCGCCTGCTCTTCTTCGAAAACTACGAGCACAACACCAGCGTCGTCAAG
AAGATCCACATTGAGGTAGTGGACAAAGCCAACAGAGACATGGCATCCATCGTGTCTGAGATCATGATGT
ATGTGCTCATTGTGGTGTTGACCATATGGCTCGTGGCAGAGATGATTTACTGCTACAAGAAGATCGCTGC
CGCCACGGAGACTGCTGCACAGGAGAATGCCTCGGAATACCTGGCCATCACCTCTGAAAGCAAAGAGAAC
TGCACGGGCGTCCAGGTGGCCGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209565 representing NM_001037
Red=Cloning site Green=Tags(s)

MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKI
LRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVK
KIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKEN
CTGVQVAE

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001037
ORF Size 654 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001037.5
RefSeq Size 1463 bp
RefSeq ORF 657 bp
Locus ID 6324
UniProt ID Q07699
Cytogenetics 19q13.11
Domains ig
Protein Families Druggable Genome, Ion Channels: Sodium, Transmembrane
Summary Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activity and the beta-1 subunit modulates the kinetics of channel inactivation. This gene encodes a sodium channel beta-1 subunit. Mutations in this gene result in generalized epilepsy with febrile seizures plus, Brugada syndrome 5, and defects in cardiac conduction. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:SCN1B (NM_001037) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209565 SCN1B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a 10 ug
$450.00
RC209565L1 Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, Myc-DDK-tagged 10 ug
$750.00
RC209565L2 Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, mGFP tagged 10 ug
$750.00
RC209565L3 Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, Myc-DDK-tagged 10 ug
$750.00
RC209565L4 Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, mGFP tagged 10 ug
$750.00
SC119540 SCN1B (untagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.