Cystatin SA (CST2) (NM_001322) Human Tagged ORF Clone

SKU
RG209350
CST2 (tGFP-tagged) - Human cystatin SA (CST2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cystatin SA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209350 representing NM_001322
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGGCCCCTGTGCACCCTGCTGCTCCTGCTGGCCACCCAGGCTGTGGCCCTGGCCTGGAGCCCCC
AGGAGGAGGACAGGATAATCGAGGGTGGCATCTATGATGCAGACCTCAATGATGAGCGGGTACAGCGTGC
CCTTCACTTTGTCATCAGCGAGTATAACAAGGCCACTGAAGATGAGTACTACAGACGCCTGCTGCGGGTG
CTACGAGCCAGGGAGCAGATCGTGGGCGGGGTGAATTACTTCTTCGACATAGAGGTGGGCCGAACCATAT
GTACCAAGTCCCAGCCCAACTTGGACACCTGTGCCTTCCATGAACAGCCAGAACTGCAGAAGAAACAGTT
GTGCTCTTTCCAGATCTACGAAGTTCCCTGGGAGGACAGAATGTCCCTGGTGAATTCCAGGTGTCAAGAA
GCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209350 representing NM_001322
Red=Cloning site Green=Tags(s)

MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV
LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE
A

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001322
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001322.3
RefSeq Size 694 bp
RefSeq ORF 426 bp
Locus ID 1470
UniProt ID P09228
Cytogenetics 20p11.21
Domains CY
Protein Families Secreted Protein
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Cystatin SA (CST2) (NM_001322) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209350 CST2 (Myc-DDK-tagged)-Human cystatin SA (CST2) 10 ug
$150.00
RC209350L3 Lenti ORF clone of Human cystatin SA (CST2), Myc-DDK-tagged 10 ug
$450.00
RC209350L4 Lenti ORF clone of Human cystatin SA (CST2), mGFP tagged 10 ug
$450.00
SC319838 CST2 (untagged)-Human cystatin SA (CST2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.