FDCSP (NM_152997) Human Tagged ORF Clone

SKU
RG209342
FDCSP (tGFP-tagged) - Human chromosome 4 open reading frame 7 (C4orf7)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FDCSP
Synonyms C4orf7; FDC-SP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209342 representing NM_152997
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAAAGTTCTCCTCCTGATCACAGCCATCTTGGCAGTGGCTGTTGGTTTCCCAGTCTCTCAAGACC
AGGAACGAGAAAAAAGAAGTATCAGTGACAGCGATGAATTAGCTTCAGGGTTTTTTGTGTTCCCTTACCC
ATATCCATTTCGCCCACTTCCACCAATTCCATTTCCAAGATTTCCATGGTTTAGACGTAATTTTCCTATT
CCAATACCTGAATCTGCCCCTACAACTCCCCTTCCTAGCGAAAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209342 representing NM_152997
Red=Cloning site Green=Tags(s)

MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPI
PIPESAPTTPLPSEK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152997
ORF Size 255 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152997.4
RefSeq Size 539 bp
RefSeq ORF 258 bp
Locus ID 260436
UniProt ID Q8NFU4
Cytogenetics 4q13
Protein Families Transmembrane
Summary This gene encodes a small secreted protein that is expressed in follicular dendritic cells. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:FDCSP (NM_152997) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209342 FDCSP (Myc-DDK-tagged)-Human chromosome 4 open reading frame 7 (C4orf7) 10 ug
$150.00
RC209342L3 Lenti ORF clone of Human chromosome 4 open reading frame 7 (C4orf7), Myc-DDK-tagged 10 ug
$450.00
RC209342L4 Lenti ORF clone of Human chromosome 4 open reading frame 7 (C4orf7), mGFP tagged 10 ug
$450.00
SC321636 FDCSP (untagged)-Human chromosome 4 open reading frame 7 (C4orf7) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.