DEFB119 (NM_153289) Human Tagged ORF Clone

SKU
RG209341
DEFB119 (tGFP-tagged) - Human defensin, beta 119 (DEFB119), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DEFB119
Synonyms DEFB-19; DEFB-20; DEFB20; DEFB120; ESC42-RELA; ESC42-RELB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209341 representing NM_153289
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTTCTTTACCTGTTTCTTGCCATCCTTCTGGCCATAGAAGAACCAGTGATATCAGGCAAACGCC
ACATCCTTCGATGCATGGGTAACAGTGGAATTTGTAGGGCCTCTTGCAAAAAGAACGAACAGCCCTACCT
CTATTGCAGAAATTGTCAGTCCTGCTGCCTCCAGTCCTACATGAGGATAAGCATTTCTGGCAAAGAGGAA
AATACCGACTGGTCTTATGAGAAGCAGTGGCCAAGACTACCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209341 representing NM_153289
Red=Cloning site Green=Tags(s)

MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEE
NTDWSYEKQWPRLP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153289
ORF Size 252 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153289.4
RefSeq Size 483 bp
RefSeq ORF 255 bp
Locus ID 245932
UniProt ID Q8N690
Cytogenetics 20q11.21
Protein Families Secreted Protein
Summary This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:DEFB119 (NM_153289) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209341 DEFB119 (Myc-DDK-tagged)-Human defensin, beta 119 (DEFB119), transcript variant 1 10 ug
$150.00
RC209341L3 Lenti ORF clone of Human defensin, beta 119 (DEFB119), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC209341L4 Lenti ORF clone of Human defensin, beta 119 (DEFB119), transcript variant 1, mGFP tagged 10 ug
$450.00
SC306581 DEFB119 (untagged)-Human defensin, beta 119 (DEFB119), transcript variant 1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.