COX4 (COX4I2) (NM_032609) Human Tagged ORF Clone

SKU
RG209204
COX4I2 (tGFP-tagged) - Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX4
Synonyms COX4; COX4-2; COX4B; COX4L2; COXIV-2; dJ857M17.2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209204 representing NM_032609
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCCCAGAGCTGCCTGGAGCTTGGTGCTGAGGAAAGGTGGAGGTGGAAGACGAGGGATGCACAGCT
CAGAAGGCACCACCCGTGGTGGGGGGAAGATGTCCCCCTACACCAACTGCTATGCCCAGCGCTACTACCC
CATGCCAGAAGAGCCCTTCTGCACAGAACTCAACGCTGAGGAGCAGGCCCTGAAGGAGAAGGAGAAGGGA
AGCTGGACCCAGCTGACCCACGCCGAAAAGGTGGCCTTGTACCGGCTCCAGTTCAATGAGACCTTTGCGG
AGATGAACCGTCGCTCCAATGAGTGGAAGACAGTGATGGGTTGTGTCTTCTTCTTCATTGGATTCGCAGC
TCTGGTGATTTGGTGGCAGCGGGTCTACGTATTTCCTCCAAAGCCGATCACCTTGACGGACGAGCGGAAA
GCCCAGCAGCTGCAGCGCATGCTGGACATGAAGGTGAATCCTGTGCAGGGCCTGGCCTCCCGCTGGGACT
ATGAGAAGAAGCAGTGGAAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209204 representing NM_032609
Red=Cloning site Green=Tags(s)

MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKG
SWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERK
AQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032609
ORF Size 513 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032609.3
RefSeq Size 684 bp
RefSeq ORF 516 bp
Locus ID 84701
UniProt ID Q96KJ9
Cytogenetics 20q11.21
Protein Families Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Summary Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:COX4 (COX4I2) (NM_032609) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209204 COX4I2 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC209204L3 Lenti ORF clone of Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC209204L4 Lenti ORF clone of Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC126284 COX4I2 (untagged)-Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.