UBE2M (NM_003969) Human Tagged ORF Clone

SKU
RG208946
UBE2M (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2M (UBE2M)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2M
Synonyms hUbc12; UBC-RS2; UBC12
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208946 representing NM_003969
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAAGCTGTTCTCGCTGAAGCAGCAGAAGAAGGAGGAGGAGTCGGCGGGCGGCACCAAGGGCAGCA
GCAAGAAGGCGTCGGCGGCGCAGCTGCGGATCCAGAAGGACATAAACGAGCTGAACCTGCCCAAGACGTG
TGATATCAGCTTCTCAGATCCAGACGACCTCCTCAACTTCAAGCTGGTCATCTGTCCTGATGAGGGCTTC
TACAAGAGTGGGAAGTTTGTGTTCAGTTTTAAGGTGGGCCAGGGTTACCCGCATGATCCCCCCAAGGTGA
AGTGTGAGACAATGGTCTATCACCCCAACATTGACCTCGAGGGCAACGTCTGCCTCAACATCCTCAGAGA
GGACTGGAAGCCAGTCCTTACGATAAACTCCATAATTTATGGCCTGCAGTATCTCTTCTTGGAGCCCAAC
CCCGAGGACCCACTGAACAAGGAGGCCGCAGAGGTCCTGCAGAACAACCGGCGGCTGTTTGAGCAGAACG
TGCAGCGCTCCATGCGGGGTGGCTACATCGGCTCCACCTACTTTGAGCGCTGCCTGAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208946 representing NM_003969
Red=Cloning site Green=Tags(s)

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGF
YKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPN
PEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003969
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003969.4
RefSeq Size 1536 bp
RefSeq ORF 552 bp
Locus ID 9040
UniProt ID P61081
Cytogenetics 19q13.43
Domains UBCc
Protein Pathways Ubiquitin mediated proteolysis
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:UBE2M (NM_003969) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208946 UBE2M (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2M (UBE2M) 10 ug
$300.00
RC208946L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2M (UBE2M), Myc-DDK-tagged 10 ug
$600.00
RC208946L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2M (UBE2M), mGFP tagged 10 ug
$600.00
RC208946L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2M (UBE2M), Myc-DDK-tagged 10 ug
$600.00
RC208946L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2M (UBE2M), mGFP tagged 10 ug
$600.00
SC117663 UBE2M (untagged)-Human ubiquitin-conjugating enzyme E2M (UBE2M) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.