AMPK beta 2 (PRKAB2) (NM_005399) Human Tagged ORF Clone

SKU
RG208766
PRKAB2 (tGFP-tagged) - Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AMPK beta 2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208766 representing NM_005399
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAACACCACCAGCGACCGGGTGTCCGGGGAGCGCCACGGCGCCAAGGCTGCACGCTCCGAGGGCG
CAGGCGGCCATGCCCCGGGGAAGGAGCACAAGATCATGGTGGGGAGTACGGACGACCCCAGCGTGTTCAG
CCTCCCTGACTCCAAGCTCCCTGGGGACAAAGAGTTTGTATCATGGCAGCAGGATTTGGAGGACTCCGTA
AAGCCCACACAGCAGGCCCGGCCCACTGTTATCCGCTGGTCTGAAGGAGGCAAGGAGGTCTTCATCTCTG
GGTCCTTCAACAATTGGAGCACCAAGATTCCACTGATTAAGAGCCATAATGACTTTGTTGCCATCCTGGA
CCTCCCTGAGGGAGAGCACCAATACAAGTTCTTTGTGGATGGACAGTGGGTTCATGATCCATCAGAGCCT
GTGGTTACCAGTCAGCTTGGCACAATTAACAATTTGATCCATGTCAAGAAATCTGATTTTGAGGTGTTCG
ATGCTTTAAAGTTAGATTCTATGGAAAGTTCTGAGACATCTTGTAGAGACCTTTCCAGCTCACCCCCAGG
GCCTTATGGTCAAGAAATGTATGCGTTTCGATCTGAGGAAAGATTCAAATCCCCACCCATCCTTCCTCCT
CATCTACTTCAAGTTATTCTTAACAAAGACACTAATATTTCTTGTGACCCAGCCTTACTCCCTGAGCCCA
ACCATGTTATGCTGAACCATCTCTATGCATTGTCCATTAAGGACAGTGTGATGGTCCTTAGCGCAACCCA
TCGCTACAAGAAGAAGTATGTTACTACTCTGCTATACAAGCCCATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208766 representing NM_005399
Red=Cloning site Green=Tags(s)

MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSV
KPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEP
VVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPP
HLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005399
ORF Size 816 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005399.5
RefSeq Size 5431 bp
RefSeq ORF 819 bp
Locus ID 5565
UniProt ID O43741
Cytogenetics 1q21.1
Domains AMPKBI
Protein Families Druggable Genome
Protein Pathways Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway
Summary The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:AMPK beta 2 (PRKAB2) (NM_005399) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208766 PRKAB2 (Myc-DDK-tagged)-Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2) 10 ug
$450.00
RC208766L1 Lenti ORF clone of Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2), Myc-DDK-tagged 10 ug
$750.00
RC208766L2 Lenti ORF clone of Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2), mGFP tagged 10 ug
$750.00
RC208766L3 Lenti ORF clone of Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2), Myc-DDK-tagged 10 ug
$750.00
RC208766L4 Lenti ORF clone of Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2), mGFP tagged 10 ug
$750.00
SC116791 PRKAB2 (untagged)-Human protein kinase, AMP-activated, beta 2 non-catalytic subunit (PRKAB2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.