NUDT10 (NM_153183) Human Tagged ORF Clone

SKU
RG208717
NUDT10 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT10
Synonyms APS2; DIPP3-alpha; DIPP3a
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208717 representing NM_153183
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTGCAAACCCAACCAGACACGGACCTACGACCCCGAGGGGTTCAAGAAGCGGGCGGCGTGCCTGT
GCTTCCGGAGCGAGCGCGAGGACGAGGTCCTGTTAGTGAGTAGCAGCCGGTACCCGGACCGCTGGATCGT
GCCGGGCGGGGGCATGGAGCCCGAGGAGGAGCCGGGCGGTGCGGCGGTCCGAGAGGTGTACGAAGAGGCG
GGAGTCAAGGGGAAGTTAGGCCGGCTCCTGGGCGTCTTCGAACAGAACCAGGACCCCGAGCACAGAACGT
ACGTGTATGTACTGACTGTCACGGAGCTGCTGGAGGATTGGGAAGATTCGGTTAGCATTGGGAGGAAGCG
AGAGTGGTTCAAAGTCGAAGATGCCATCAAGGTTCTCCAGTGCCACAAGCCCGTGCACGCCGAATATCTG
GAGAAACTAAAGCTGGGCGGTTCCCCAACCAATGGAAACTCCATGGCCCCATCCTCGCCAGATAGCGATC
CC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208717 representing NM_153183
Red=Cloning site Green=Tags(s)

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA
GVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL
EKLKLGGSPTNGNSMAPSSPDSDP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153183
ORF Size 492 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153183.1, NP_694853.1
RefSeq Size 2020 bp
RefSeq ORF 495 bp
Locus ID 170685
UniProt ID Q8NFP7
Cytogenetics Xp11.22
Summary This gene is a member of the nudix (nucleoside diphosphate linked moiety X)-type motif containing family. The encoded protein is a phosphohydrolase and may regulate the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to the regulation of intracellular trafficking. In some populations putative prostate cancer susceptibility alleles have been identified for this gene. Alternatively spliced transcript variants, which differ only in the 5' UTR, have been found for this gene. [provided by RefSeq, Feb 2015]
Write Your Own Review
You're reviewing:NUDT10 (NM_153183) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208717 NUDT10 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10) 10 ug
$150.00
RC208717L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10), Myc-DDK-tagged 10 ug
$450.00
RC208717L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10), mGFP tagged 10 ug
$450.00
SC121189 NUDT10 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10) 10 ug
$150.00
SC323851 NUDT10 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.