beta Defensin 1 (DEFB1) (NM_005218) Human Tagged ORF Clone

SKU
RG208244
DEFB1 (tGFP-tagged) - Human defensin, beta 1 (DEFB1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol beta Defensin 1
Synonyms BD1; DEFB-1; DEFB101; HBD1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208244 representing NM_005218
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAACTTCCTACCTTCTGCTGTTTACTCTCTGCTTACTTTTGTCTGAGATGGCCTCAGGTGGTAACT
TTCTCACAGGCCTTGGCCACAGATCTGATCATTACAATTGCGTCAGCAGTGGAGGGCAATGTCTCTATTC
TGCCTGCCCGATCTTTACCAAAATTCAAGGCACCTGTTACAGAGGGAAGGCCAAGTGCTGCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208244 representing NM_005218
Red=Cloning site Green=Tags(s)

MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005218
ORF Size 204 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005218.4
RefSeq Size 484 bp
RefSeq ORF 207 bp
Locus ID 1672
UniProt ID P60022
Cytogenetics 8p23.1
Domains Defensin_beta
Protein Families Secreted Protein
Summary Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:beta Defensin 1 (DEFB1) (NM_005218) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208244 DEFB1 (Myc-DDK-tagged)-Human defensin, beta 1 (DEFB1) 10 ug
$150.00
RC208244L1 Lenti ORF clone of Human defensin, beta 1 (DEFB1), Myc-DDK-tagged 10 ug
$450.00
RC208244L2 Lenti ORF clone of Human defensin, beta 1 (DEFB1), mGFP tagged 10 ug
$450.00
RC208244L3 Lenti ORF clone of Human defensin, beta 1 (DEFB1), Myc-DDK-tagged 10 ug
$450.00
RC208244L4 Lenti ORF clone of Human defensin, beta 1 (DEFB1), mGFP tagged 10 ug
$450.00
SC116851 DEFB1 (untagged)-Human defensin, beta 1 (DEFB1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.