UBL4A (NM_014235) Human Tagged ORF Clone

SKU
RG208121
UBL4A (tGFP-tagged) - Human ubiquitin-like 4A (UBL4A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBL4A
Synonyms DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208121 representing NM_014235
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCTGACGGTGAAGGCGCTGCAGGGCCGCGAGTGCAGCCTGCAGGTGCCAGAGGACGAGCTGGTGT
CCACGCTGAAGCAGCTGGTCTCCGAGAAGCTGAACGTCCCAGTGCGCCAGCAGCGGCTGCTGTTCAAGGG
CAAGGCCCTGGCAGATGGGAAACGACTCTCGGATTATAGCATCGGGCCCAACTCCAAGCTCAACCTAGTG
GTCAAACCCCTGGAGAAGGTGCTACTAGAAGAAGGCGAGGCCCAGAGGCTGGCCGACTCCCCACCCCCGC
AGGTCTGGCAGCTGATCTCCAAAGTCTTGGCCCGCCACTTCAGTGCGGCAGATGCCAGCAGGGTCCTGGA
ACAGCTACAGAGGGATTACGAGAGGTCCCTGAGTCGCCTGACGCTGGACGACATCGAACGGTTGGCCAGC
CGCTTCCTGCACCCTGAAGTGACTGAGACAATGGAGAAGGGCTTCTCCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208121 representing NM_014235
Red=Cloning site Green=Tags(s)

MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV
VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS
RFLHPEVTETMEKGFSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014235
ORF Size 471 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014235.5
RefSeq Size 2322 bp
RefSeq ORF 474 bp
Locus ID 8266
UniProt ID P11441
Cytogenetics Xq28
Domains UBQ
Protein Families Druggable Genome
Summary As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation (PubMed:20676083, PubMed:21636303, PubMed:21743475, PubMed:28104892). The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum (PubMed:20676083, PubMed:28104892, PubMed:25535373). Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome (PubMed:28104892). Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum (PubMed:21743475). The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome (PubMed:21636303).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:UBL4A (NM_014235) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208121 UBL4A (Myc-DDK-tagged)-Human ubiquitin-like 4A (UBL4A) 10 ug
$150.00
RC208121L1 Lenti ORF clone of Human ubiquitin-like 4A (UBL4A), Myc-DDK-tagged 10 ug
$450.00
RC208121L2 Lenti ORF clone of Human ubiquitin-like 4A (UBL4A), mGFP tagged 10 ug
$450.00
RC208121L3 Lenti ORF clone of Human ubiquitin-like 4A (UBL4A), Myc-DDK-tagged 10 ug
$450.00
RC208121L4 Lenti ORF clone of Human ubiquitin-like 4A (UBL4A), mGFP tagged 10 ug
$450.00
SC111067 UBL4A (untagged)-Human ubiquitin-like 4A (UBL4A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.