SURF5 (MED22) (NM_181491) Human Tagged ORF Clone

SKU
RG208015
MED22 (tGFP-tagged) - Human mediator complex subunit 22 (MED22), transcript variant c
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SURF5
Synonyms MED24; SRB6; surf-5; SURF5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208015 representing NM_181491
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGCAGAGAGCCCTGCCCCAGAGCAAGGAGACGCTGCTGCAGTCCTACAACAAGCGGCTGAAGG
ACGACATTAAGTCCATCATGGACAACTTCACCGAGATCATCAAGACCGCCAAGATTGAGGACGAGACGCA
GGTGTCACGGGCCACTCAGGGTGAACAGGACAATTACGAGATGCATGTGCGAGCCGCCAACATCGTCCGA
GCCGGCGAGTCCCTGATGAAGCTGGTGTCCGACCTCAAGCAGTTCCTGATCCTCAATGACTTCCCCTCCG
TGAACGAGGCCATTGACCAGCGCAACCAGCAGCTGCGCACACTGCAGGAGGAGTGCGACCGGAAGCTCAT
CACGCTGCGAGACGAGATCTCCATTGACCTCTACGAGCTGGAGGAGGAGTATTACTCGTCCAGGTATAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208015 representing NM_181491
Red=Cloning site Green=Tags(s)

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR
AGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181491
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181491.2
RefSeq Size 3887 bp
RefSeq ORF 423 bp
Locus ID 6837
UniProt ID Q15528
Cytogenetics 9q34.2
Summary This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:SURF5 (MED22) (NM_181491) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208015 MED22 (Myc-DDK-tagged)-Human mediator complex subunit 22 (MED22), transcript variant c 10 ug
$150.00
RC208015L3 Lenti ORF clone of Human mediator complex subunit 22 (MED22), transcript variant c, Myc-DDK-tagged 10 ug
$450.00
RC208015L4 Lenti ORF clone of Human mediator complex subunit 22 (MED22), transcript variant c, mGFP tagged 10 ug
$450.00
SC324098 MED22 (untagged)-Human mediator complex subunit 22 (MED22), transcript variant c 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.