SDF1 (CXCL12) (NM_199168) Human Tagged ORF Clone

SKU
RG207891
CXCL12 (tGFP-tagged) - Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$440.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SDF1
Synonyms IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207891 representing NM_199168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGCCAAGGTCGTGGTCGTGCTGGTCCTCGTGCTGACCGCGCTCTGCCTCAGCGACGGGAAGCCCG
TCAGCCTGAGCTACAGATGCCCATGCCGATTCTTCGAAAGCCATGTTGCCAGAGCCAACGTCAAGCATCT
CAAAATTCTCAACACTCCAAACTGTGCCCTTCAGATTGTAGCCCGGCTGAAGAACAACAACAGACAAGTG
TGCATTGACCCGAAGCTAAAGTGGATTCAGGAGTACCTGGAGAAAGCTTTAAACAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207891 representing NM_199168
Red=Cloning site Green=Tags(s)

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV
CIDPKLKWIQEYLEKALNK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_199168
ORF Size 267 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_199168.4
RefSeq Size 1937 bp
RefSeq ORF 270 bp
Locus ID 6387
UniProt ID P48061
Cytogenetics 10q11.21
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration
Summary This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:SDF1 (CXCL12) (NM_199168) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207891 CXCL12 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$240.00
RC207891L1 Lenti-ORF clone of CXCL12 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$540.00
RC207891L2 Lenti-ORF clone of CXCL12 (mGFP-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$540.00
RC207891L3 Lenti-ORF clone of CXCL12 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$540.00
RC207891L4 Lenti-ORF clone of CXCL12 (mGFP-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$540.00
SC127614 CXCL12 (untagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.