SRXN1 (NM_080725) Human Tagged ORF Clone

SKU
RG207654
SRXN1 (tGFP-tagged) - Human sulfiredoxin 1 (SRXN1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SRXN1
Synonyms C20orf139; Npn3; SRX; SRX1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207654 representing NM_080725
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGCGTGCAGGAGGAACGCTGGGCAGGGCCGGCGCGGGTCGGGGGGCGCCCGAGGGGCCCGGGC
CGAGCGGCGGCGCGCAGGGCGGCAGCATCCACTCGGGCCGCATCGCCGCGGTGCACAACGTGCCGCTGAG
CGTGCTCATCCGGCCGCTGCCGTCCGTGTTGGACCCCGCCAAGGTGCAGAGCCTCGTGGACACGATCCGG
GAGGACCCAGACAGCGTGCCCCCCATCGATGTCCTCTGGATCAAAGGGGCCCAGGGAGGTGACTACTTCT
ACTCCTTTGGGGGCTGCCACCGCTACGCGGCCTACCAGCAACTGCAGCGAGAGACCATCCCCGCCAAGCT
TGTCCAGTCCACTCTCTCAGACCTAAGGGTGTACCTGGGAGCATCCACACCAGACTTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207654 representing NM_080725
Red=Cloning site Green=Tags(s)

MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIR
EDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080725
ORF Size 411 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080725.3
RefSeq Size 2580 bp
RefSeq ORF 414 bp
Locus ID 140809
UniProt ID Q9BYN0
Cytogenetics 20p13
Summary Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SRXN1 (NM_080725) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207654 SRXN1 (Myc-DDK-tagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$225.00
RC207654L1 Lenti-ORF clone of SRXN1 (Myc-DDK-tagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$525.00
RC207654L2 Lenti-ORF clone of SRXN1 (mGFP-tagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$525.00
RC207654L3 Lenti-ORF clone of SRXN1 (Myc-DDK-tagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$525.00
RC207654L4 Lenti-ORF clone of SRXN1 (mGFP-tagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$525.00
SC100260 SRXN1 (untagged)-Human sulfiredoxin 1 (SRXN1) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.