Somatostatin (SST) (NM_001048) Human Tagged ORF Clone

SKU
RG207601
SST (tGFP-tagged) - Human somatostatin (SST)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Somatostatin
Synonyms SMST; SST1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207601 representing NM_001048
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCCTGCCGCCTCCAGTGCGCGCTGGCTGCGCTGTCCATCGTCCTGGCCCTGGGCTGTGTCACCG
GCGCTCCCTCGGACCCCAGACTCCGTCAGTTTCTGCAGAAGTCCCTGGCTGCTGCCGCGGGGAAGCAGGA
ACTGGCCAAGTACTTCTTGGCAGAGCTGCTGTCTGAACCCAACCAGACGGAGAATGATGCCCTGGAACCT
GAAGATCTGTCCCAGGCTGCTGAGCAGGATGAAATGAGGCTTGAGCTGCAGAGATCTGCTAACTCAAACC
CGGCTATGGCACCCCGAGAACGCAAAGCTGGCTGCAAGAATTTCTTCTGGAAGACTTTCACATCCTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207601 representing NM_001048
Red=Cloning site Green=Tags(s)

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP
EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001048
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001048.4
RefSeq Size 665 bp
RefSeq ORF 351 bp
Locus ID 6750
UniProt ID P61278
Cytogenetics 3q27.3
Domains Somatostatin
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Summary The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Somatostatin (SST) (NM_001048) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207601 SST (Myc-DDK-tagged)-Human somatostatin (SST) 10 ug
$150.00
RC207601L3 Lenti ORF clone of Human somatostatin (SST), Myc-DDK-tagged 10 ug
$450.00
RC207601L4 Lenti ORF clone of Human somatostatin (SST), mGFP tagged 10 ug
$450.00
SC119480 SST (untagged)-Human somatostatin (SST) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.