liver FABP (FABP1) (NM_001443) Human Tagged ORF Clone

SKU
RG207592
FABP1 (tGFP-tagged) - Human fatty acid binding protein 1, liver (FABP1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol liver FABP
Synonyms FABPL; L-FABP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207592 representing NM_001443
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTTCTCCGGCAAGTACCAACTGCAGAGCCAGGAAAACTTTGAAGCCTTCATGAAGGCAATCGGTC
TGCCGGAAGAGCTCATCCAGAAGGGGAAGGATATCAAGGGGGTGTCGGAAATCGTGCAGAATGGGAAGCA
CTTCAAGTTCACCATCACCGCTGGGTCCAAAGTGATCCAAAACGAATTCACGGTGGGGGAGGAATGTGAG
CTGGAGACAATGACAGGGGAGAAAGTCAAGACAGTGGTTCAGTTGGAAGGTGACAATAAACTGGTGACAA
CTTTCAAAAACATCAAGTCTGTGACCGAACTCAACGGCGACATAATCACCAATACCATGACATTGGGTGA
CATTGTCTTCAAGAGAATCAGCAAGAGAATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207592 representing NM_001443
Red=Cloning site Green=Tags(s)

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001443
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001443.3
RefSeq Size 489 bp
RefSeq ORF 384 bp
Locus ID 2168
UniProt ID P07148
Cytogenetics 2p11.2
Domains lipocalin
Protein Pathways PPAR signaling pathway
Summary This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
Write Your Own Review
You're reviewing:liver FABP (FABP1) (NM_001443) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207592 FABP1 (Myc-DDK-tagged)-Human fatty acid binding protein 1, liver (FABP1) 10 ug
$150.00
RC207592L1 Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), Myc-DDK-tagged 10 ug
$450.00
RC207592L2 Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), mGFP tagged 10 ug
$450.00
RC207592L3 Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), Myc-DDK-tagged 10 ug
$450.00
RC207592L4 Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), mGFP tagged 10 ug
$450.00
SC119222 FABP1 (untagged)-Human fatty acid binding protein 1, liver (FABP1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.