FCER1G (NM_004106) Human Tagged ORF Clone

SKU
RG207585
FCER1G (tGFP-tagged) - Human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FCER1G
Synonyms FCRG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207585 representing NM_004106
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGC
TCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAA
GGTAATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGC
ACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207585 representing NM_004106
Red=Cloning site Green=Tags(s)

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLS
TRNQETYETLKHEKPPQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004106
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004106.1, NP_004097.1
RefSeq Size 591 bp
RefSeq ORF 261 bp
Locus ID 2207
UniProt ID P30273
Cytogenetics 1q23.3
Domains ITAM
Protein Families Transmembrane
Protein Pathways Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity
Summary The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FCER1G (NM_004106) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207585 FCER1G (Myc-DDK-tagged)-Human Fc fragment of IgE, high affinity I, receptor for, gamma polypeptide (FCER1G) 10 ug
$150.00
RC207585L1 Lenti ORF clone of Human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), Myc-DDK-tagged 10 ug
$450.00
RC207585L2 Lenti ORF clone of Human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), mGFP tagged 10 ug
$450.00
RC207585L3 Lenti ORF clone of Human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), Myc-DDK-tagged 10 ug
$450.00
RC207585L4 Lenti ORF clone of Human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), mGFP tagged 10 ug
$450.00
SC117594 FCER1G (untagged)-Human Fc fragment of IgE, high affinity I, receptor for, gamma polypeptide (FCER1G) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.