Bim (BCL2L11) (NM_138621) Human Tagged ORF Clone

SKU
RG207559
BCL2L11 (tGFP-tagged) - Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Bim
Synonyms BAM; BIM; BOD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207559 representing NM_138621
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGGCGCGCCC

ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGA
GGCCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAA
TCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGCCCTCAGGGCCCGCTGGCCCCACCTGCCAGCCCT
GGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTGTCTCGATCCTCCA
GTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCC
AAGTCCTCCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCA
GATATGCGCCCAGAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATG
CAAGGAGGGTATTTTTGAATAATTACCAAGCAGCCGAAGACCACCCACGAATGGTTATCTTACGACTGTT
ACGTTACATTGTCCGCCTGGTGTGGAGAATGCAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207559 representing NM_138621
Red=Cloning site Green=Tags(s)

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

TRTRPLE - GFP Tag - V
Restriction Sites AscI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138621
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138621.5
RefSeq Size 3422 bp
RefSeq ORF 597 bp
Locus ID 10018
UniProt ID O43521
Cytogenetics 2q13
Protein Families Druggable Genome
Summary The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2013]
Write Your Own Review
You're reviewing:Bim (BCL2L11) (NM_138621) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207559 BCL2L11 (Myc-DDK-tagged)-Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC207559L1 Lenti ORF clone of Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207559L2 Lenti ORF clone of Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1, mGFP tagged 10 ug
$600.00
RC207559L3 Lenti ORF clone of Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207559L4 Lenti ORF clone of Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1, mGFP tagged 10 ug
$600.00
SC306048 BCL2L11 (untagged)-Human BCL2-like 11 (apoptosis facilitator) (BCL2L11), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.