Mimitin (NDUFAF2) (NM_174889) Human Tagged ORF Clone

SKU
RG207387
NDUFAF2 (tGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Mimitin
Synonyms B17.2L; MC1DN10; mimitin; MMTN; NDUFA12L
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207387 representing NM_174889
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTGGTCTCAGGATTTGTTCCGCGCCTTGTGGAGATCGCTGTCAAGGGAAGTGAAGGAGCACGTGG
GCACGGACCAATTCGGGAACAAATACTACTACATCCCGCAGTACAAGAACTGGAGAGGACAAACTATTCG
AGAGAAAAGAATTGTAGAAGCAGCAAATAAAAAAGAAGTAGACTATGAAGCAGGGGATATTCCAACAGAA
TGGGAAGCTTGGATTAGAAGAACAAGAAAGACTCCACCTACTATGGAGGAAATACTAAAGAATGAAAAAC
ACAGAGAAGAAATCAAAATAAAAAGCCAAGATTTTTATGAAAAAGAAAAACTCCTTAGTAAAGAGACCAG
TGAGGAACTCCTGCCTCCACCAGTTCAAACTCAAATTAAAGGCCATGCCTCTGCTCCATACTTTGGAAAG
GAAGAACCCTCAGTGGCTCCCAGCAGCACTGGTAAAACCTTTCAGCCAGGATCCTGGATGCCACGAGATG
GCAAGAGCCACAATCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207387 representing NM_174889
Red=Cloning site Green=Tags(s)

MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTE
WEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGK
EEPSVAPSSTGKTFQPGSWMPRDGKSHNQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_174889
ORF Size 507 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174889.5
RefSeq Size 650 bp
RefSeq ORF 510 bp
Locus ID 91942
UniProt ID Q8N183
Cytogenetics 5q12.1
Summary NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Mimitin (NDUFAF2) (NM_174889) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207387 NDUFAF2 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC207387L3 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC207387L4 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC320112 NDUFAF2 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.