CD94 (KLRD1) (NM_002262) Human Tagged ORF Clone

SKU
RG206991
KLRD1 (tGFP-tagged) - Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD94
Synonyms CD94
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206991 representing NM_002262
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTGTTTAAGACCACTCTGTGGAGGTTAATTTCTGGGACCTTAGGGATAATATGCCTTTCGTTGA
TGGCTACGTTGGGAATTTTGTTGAAAAATTCTTTTACTAAACTGAGTATTGAGCCAGCATTTACTCCAGG
ACCCAACATAGAACTCCAGAAAGACTCTGACTGCTGTTCTTGCCAAGAAAAATGGGTTGGGTACCGGTGC
AACTGTTACTTCATTTCCAGTGAACAGAAAACTTGGAACGAAAGTCGGCATCTCTGTGCTTCTCAGAAAT
CCAGCCTGCTTCAGCTTCAAAACACAGATGAACTGGATTTTATGAGCTCCAGTCAACAATTTTACTGGAT
TGGACTCTCTTACAGTGAGGAGCACACCGCCTGGTTGTGGGAGAATGGCTCTGCACTCTCCCAGTATCTA
TTTCCATCATTTGAAACTTTTAATACAAAGAACTGCATAGCGTATAATCCAAATGGAAATGCTTTAGATG
AATCCTGTGAAGATAAAAATCGTTATATCTGTAAGCAACAGCTCATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206991 representing NM_002262
Red=Cloning site Green=Tags(s)

MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC
NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL
FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002262
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002262.3
RefSeq Size 1364 bp
RefSeq ORF 540 bp
Locus ID 3824
UniProt ID Q13241
Cytogenetics 12p13.2
Protein Families Transmembrane
Protein Pathways Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity
Summary Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]
Write Your Own Review
You're reviewing:CD94 (KLRD1) (NM_002262) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206991 KLRD1 (Myc-DDK-tagged)-Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1 10 ug
$300.00
RC206991L1 Lenti ORF clone of Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206991L2 Lenti ORF clone of Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC206991L3 Lenti ORF clone of Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206991L4 Lenti ORF clone of Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, mGFP tagged 10 ug
$600.00
SC323944 KLRD1 (untagged)-Human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.