Kisspeptin (KISS1) (NM_002256) Human Tagged ORF Clone
SKU
RG206859
KISS1 (tGFP-tagged) - Human KiSS-1 metastasis-suppressor (KISS1)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Kisspeptin |
Synonyms | HH13; KiSS-1 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RG206859 representing NM_002256
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACTCACTGGTTTCTTGGCAGCTACTGCTTTTCCTCTGTGCCACCCACTTTGGGGAGCCATTAGAAA AGGTGGCCTCTGTGGGGAATTCTAGACCCACAGGCCAGCAGCTAGAATCCCTGGGCCTCCTGGCCCCCGG GGAGCAGAGCCTGCCGTGCACCGAGAGGAAGCCAGCTGCTACTGCCAGGCTGAGCCGTCGGGGGACCTCG CTGTCCCCGCCCCCCGAGAGCTCCGGGAGCCCCCAGCAGCCGGGCCTGTCCGCCCCCCACAGCCGCCAGA TCCCCGCACCCCAGGGCGCGGTGCTGGTGCAGCGGGAGAAGGACCTGCCGAACTACAACTGGAACTCCTT CGGCCTGCGCTTCGGCAAGCGGGAGGCGGCACCAGGGAACCACGGCAGAAGCGCTGGGCGGGGC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206859 representing NM_002256
Red=Cloning site Green=Tags(s) MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002256 |
ORF Size | 414 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_002256.4 |
RefSeq Size | 725 bp |
RefSeq ORF | 417 bp |
Locus ID | 3814 |
UniProt ID | Q15726 |
Cytogenetics | 1q32.1 |
Protein Families | Druggable Genome, Secreted Protein |
Summary | This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues. [provided by RefSeq, Mar 2012] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC206859 | KISS1 (Myc-DDK-tagged)-Human KiSS-1 metastasis-suppressor (KISS1) | 10 ug |
$225.00
|
|
RC206859L1 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), Myc-DDK-tagged | 10 ug |
$525.00
|
|
RC206859L2 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), mGFP tagged | 10 ug |
$525.00
|
|
RC206859L3 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), Myc-DDK-tagged | 10 ug |
$525.00
|
|
RC206859L4 | Lenti ORF clone of Human KiSS-1 metastasis-suppressor (KISS1), mGFP tagged | 10 ug |
$525.00
|
|
SC122622 | KISS1 (untagged)-Human KiSS-1 metastasis-suppressor (KISS1) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.