DHLAG (CD74) (NM_001025158) Human Tagged ORF Clone
SKU
RG206830
CD74 (tGFP-tagged) - Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | DHLAG |
Synonyms | DHLAG; HLADG; Ia-GAMMA; II; p33 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
Protein Sequence
>RG206830 representing NM_001025158
Red=Cloning site Green=Tags(s) MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED HVMHLLQSHWNWRTRLLGWV TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001025158 |
ORF Size | 480 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001025158.2 |
RefSeq Size | 1155 bp |
RefSeq ORF | 483 bp |
Locus ID | 972 |
UniProt ID | P04233 |
Cytogenetics | 5q33.1 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Summary | The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC206830 | CD74 (Myc-DDK-tagged)-Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3 | 10 ug |
$150.00
|
|
RC206830L1 | Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC206830L2 | Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3, mGFP tagged | 10 ug |
$450.00
|
|
RC206830L3 | Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC206830L4 | Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3, mGFP tagged | 10 ug |
$450.00
|
|
SC319577 | CD74 (untagged)-Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.