CART (CARTPT) (NM_004291) Human Tagged ORF Clone

SKU
RG206552
CARTPT (tGFP-tagged) - Human CART prepropeptide (CARTPT)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CART
Synonyms CART
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206552 representing NM_004291
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGCTCCCGCGTGAGGCTGCTGCCCCTCCTGGGCGCCGCCCTGCTGCTGATGCTACCTCTGTTGG
GTACCCGTGCCCAGGAGGACGCCGAGCTCCAGCCCCGAGCCCTGGACATCTACTCTGCCGTGGATGATGC
CTCCCACGAGAAGGAGCTGATCGAAGCGCTGCAAGAAGTCTTGAAGAAGCTCAAGAGTAAACGTGTTCCC
ATCTATGAGAAGAAGTATGGCCAAGTCCCCATGTGTGACGCCGGTGAGCAGTGTGCAGTGAGGAAAGGGG
CAAGGATCGGGAAGCTGTGTGACTGTCCCCGAGGAACCTCCTGCAATTCCTTCCTCCTGAAGTGCTTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206552 representing NM_004291
Red=Cloning site Green=Tags(s)

MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP
IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004291
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004291.4
RefSeq Size 908 bp
RefSeq ORF 351 bp
Locus ID 9607
UniProt ID Q16568
Cytogenetics 5q13.2
Protein Families Secreted Protein
Summary This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:CART (CARTPT) (NM_004291) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206552 CARTPT (Myc-DDK-tagged)-Human CART prepropeptide (CARTPT) 10 ug
$150.00
RC206552L1 Lenti ORF clone of Human CART prepropeptide (CARTPT), Myc-DDK-tagged 10 ug
$450.00
RC206552L2 Lenti ORF clone of Human CART prepropeptide (CARTPT), mGFP tagged 10 ug
$450.00
RC206552L3 Lenti ORF clone of Human CART prepropeptide (CARTPT), Myc-DDK-tagged 10 ug
$450.00
RC206552L4 Lenti ORF clone of Human CART prepropeptide (CARTPT), mGFP tagged 10 ug
$450.00
SC303462 CARTPT (untagged)-Human CART prepropeptide (CARTPT) 10 ug
$150.00
SC322555 CARTPT (untagged)-Human CART prepropeptide (CARTPT) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.