RAMP2 (NM_005854) Human Tagged ORF Clone

SKU
RG206531
RAMP2 (tGFP-tagged) - Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Target Symbol RAMP2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206531 representing NM_005854
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCGCTCCGGGTGGAGCGCGCCGGCGGCCCGCGTCTCCCTAGGACCCGAGTCGGGCGGCCGGCAG
CGCTCCGCCTCCTCCTCCTGCTGGGCGCTGTCCTGAATCCCCACGAGGCCCTGGCTCAGCCTCTTCCCAC
CACAGGCACACCAGGGTCAGAAGGGGGGACGGTGAAGAACTATGAGACAGCTGTCCAATTTTGCTGGAAT
CATTATAAGGATCAAATGGATCCTATCGAAAAGGATTGGTGCGACTGGGCCATGATTAGCAGGCCTTATA
GCACCCTGCGAGATTGCCTGGAGCACTTTGCAGAGTTGTTTGACCTGGGCTTCCCCAATCCCTTGGCAGA
GAGGATCATCTTTGAGACTCACCAGATCCACTTTGCCAACTGCTCCCTGGTGCAGCCCACCTTCTCTGAC
CCCCCAGAGGATGTACTCCTGGCCATGATCATAGCCCCCATCTGCCTCATCCCCTTCCTCATCACTCTTG
TAGTATGGAGGAGTAAAGACAGTGAGGCCCAGGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206531 representing NM_005854
Red=Cloning site Green=Tags(s)

MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWN
HYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSD
PPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005854
ORF Size 525 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005854.3
RefSeq Size 808 bp
RefSeq ORF 528 bp
Locus ID 10266
UniProt ID O60895
Cytogenetics 17q21.2
Domains RAMP
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vascular smooth muscle contraction
Summary The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RAMP2 (NM_005854) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206531 RAMP2 (Myc-DDK-tagged)-Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2) 10 ug
$450.00
RC206531L1 Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), Myc-DDK-tagged 10 ug
$750.00
RC206531L2 Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), mGFP tagged 10 ug
$750.00
RC206531L3 Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), Myc-DDK-tagged 10 ug
$750.00
RC206531L4 Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), mGFP tagged 10 ug
$750.00
SC310647 RAMP2 (untagged)-Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.