RYBP (NM_012234) Human Tagged ORF Clone

SKU
RG206186
RYBP (tGFP-tagged) - Human RING1 and YY1 binding protein (RYBP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RYBP
Synonyms AAP1; APAP-1; DEDAF; YEAF1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206186 representing NM_012234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCATGGGCGACAAGAAGAGCCCGACCAGGCCAAAAAGACAAGCGAAACCTGCCACAGACGAAGGGT
TTTGGGATTGTAGCGTCTGCACCTTCAGAAACAGTGCTGAAGCCTTTAAATGCAGCATCTGCGATGTGAG
GAAAGGCACCTCCACCAGAAAACCTCGGATCAATTCTCAGCTGGTGGCACAACAAGTGGCACAACAGTAT
GCCACCCCACCACCCCCTAAAAAGGAGAAGAAGGAGAAAGTTGAAAAGCAGGACAAAGAGAAACCTGAGA
AAGACAAGGAAATTAGTCCTAGTGTTACCAAGAAAAATACCAACAAGAAAACCAAACCAAAGTCTGACAT
TCTGAAAGATCCTCCTAGTGAAGCAAACAGCATACAGTCTGCAAATGCTACAACAAAGACCAGCGAAACA
AATCACACCTCAAGGCCCCGGCTGAAAAACGTGGACAGGAGCACTGCACAGCAGTTGGCAGTAACTGTGG
GCAACGTCACCGTCATTATCACAGACTTTAAGGAAAAGACTCGCTCCTCATCGACATCCTCATCCACAGT
GACCTCCAGTGCAGGGTCAGAACAGCAGAACCAGAGCAGCTCGGGGTCAGAGAGCACAGACAAGGGCTCC
TCCCGTTCCTCCACGCCAAAGGGCGACATGTCAGCAGTCAATGATGAATCTTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206186 representing NM_012234
Red=Cloning site Green=Tags(s)

MTMGDKKSPTRPKRQAKPATDEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY
ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET
NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS
SRSSTPKGDMSAVNDESF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012234
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012234.3, NP_036366.2
RefSeq Size 4562 bp
RefSeq ORF 687 bp
Locus ID 23429
UniProt ID Q8N488
Cytogenetics 3p13
Domains zf-RanBP
Protein Families Druggable Genome, Transcription Factors
Summary Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:25519132). Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites (By similarity). Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes (PubMed:19098711). May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis (PubMed:14765135, PubMed:27060496). May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 (PubMed:11953439). May bind to DNA (By similarity). May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3 (PubMed:27748911).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RYBP (NM_012234) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206186 RYBP (Myc-DDK-tagged)-Human RING1 and YY1 binding protein (RYBP) 10 ug
$300.00
RC206186L1 Lenti ORF clone of Human RING1 and YY1 binding protein (RYBP), Myc-DDK-tagged 10 ug
$600.00
RC206186L2 Lenti ORF clone of Human RING1 and YY1 binding protein (RYBP), mGFP tagged 10 ug
$600.00
RC206186L3 Lenti ORF clone of Human RING1 and YY1 binding protein (RYBP), Myc-DDK-tagged 10 ug
$600.00
RC206186L4 Lenti ORF clone of Human RING1 and YY1 binding protein (RYBP), mGFP tagged 10 ug
$600.00
SC128221 RYBP (untagged)-Human RING1 and YY1 binding protein (RYBP) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.