SAP18 (NM_005870) Human Tagged ORF Clone

SKU
RG205607
SAP18 (tGFP-tagged) - Human Sin3A-associated protein, 18kDa (SAP18)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SAP18
Synonyms 2HOR0202; SAP18P
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205607 representing NM_005870
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGGAGTCGCGCGTTACCCAGGAGGAAATTAAGAAGGAGCCAGAGAAACCGATCGACCGCGAGA
AGACATGCCCACTGTTGCTACGGGTCTTCACCACCAATAACGGCCGCCACCACCGAATGGACGAGTTCTC
CCGGGGAAATGTACCGTCCAGCGAGTTGCAGATCTACACTTGGATGGATGCAACTTTGAAAGAACTGACA
AGCTTAGTAAAAGAAGTCTACCCAGAAGCTAGAAAGAAGGGCACTCACTTCAATTTTGCAATCGTTTTTA
CAGATGTTAAAAGACCTGGCTATCGAGTTAAGGAAATTGGCAGCACCATGTCTGGCAGAAAGGGGACTGA
TGATTCCATGACCCTGCAGTCGCAGAAGTTCCAGATAGGAGATTACTTGGACATAGCAATTACCCCTCCA
AATCGGGCACCACCTACTTCAGGGCGCATGAGACCATAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205607 representing NM_005870
Red=Cloning site Green=Tags(s)

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP
NRAPPTSGRMRPY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005870
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005870.3, NP_005861.1
RefSeq Size 2035 bp
RefSeq ORF 519 bp
Locus ID 10284
UniProt ID O00422
Cytogenetics 13q12.11
Protein Families Druggable Genome, Transcription Factors
Summary Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:SAP18 (NM_005870) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205607 SAP18 (Myc-DDK-tagged)-Human Sin3A-associated protein, 18kDa (SAP18) 10 ug
$150.00
RC205607L1 Lenti ORF clone of Human Sin3A-associated protein, 18kDa (SAP18), Myc-DDK-tagged 10 ug
$450.00
RC205607L2 Lenti ORF clone of Human Sin3A-associated protein, 18kDa (SAP18), mGFP tagged 10 ug
$450.00
RC205607L3 Lenti ORF clone of Human Sin3A-associated protein, 18kDa (SAP18), Myc-DDK-tagged 10 ug
$450.00
RC205607L4 Lenti ORF clone of Human Sin3A-associated protein, 18kDa (SAP18), mGFP tagged 10 ug
$450.00
SC111144 SAP18 (untagged)-Human Sin3A-associated protein, 18kDa (SAP18) 10 ug
$150.00
SC327746 SAP18 (untagged)-Human Sin3A-associated protein 18kDa (SAP18) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.