SMCP (NM_030663) Human Tagged ORF Clone

SKU
RG205294
SMCP (tGFP-tagged) - Human sperm mitochondria-associated cysteine-rich protein (SMCP), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SMCP
Synonyms HSMCSGEN1; MCS; MCSP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205294 representing NM_030663
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGACCAGACAAAACACAGTAAATGCTGCCCAGCAAAAGGCAATCAATGCTGCCCACCACAGCAGA
ACCAGTGCTGCCAGTCAAAAGGCAATCAATGCTGCCCACCAAAACAGAACCAGTGCTGCCAGCCAAAAGG
CAGTCAATGCTGCCCACCAAAACACAATCACTGCTGCCAGCCAAAACCCCCATGCTGCATTCAGGCCAGG
TGCTGTGGTTTGGAGACCAAGCCTGAAGTCTCACCCCTTAACATGGAGTCTGAGCCCAACTCACCGCAAA
CTCAGGACAAGGGCTGTCAAACCCAGCAGCAGCCCCATAGCCCACAAAATGAGTCCAGGCCAAGCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205294 representing NM_030663
Red=Cloning site Green=Tags(s)

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQAR
CCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030663
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030663.3
RefSeq Size 784 bp
RefSeq ORF 351 bp
Locus ID 4184
UniProt ID P49901
Cytogenetics 1q21.3
Summary Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SMCP (NM_030663) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205294 SMCP (Myc-DDK-tagged)-Human sperm mitochondria-associated cysteine-rich protein (SMCP), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC205294L3 Lenti ORF clone of Human sperm mitochondria-associated cysteine-rich protein (SMCP), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC205294L4 Lenti ORF clone of Human sperm mitochondria-associated cysteine-rich protein (SMCP), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC122990 SMCP (untagged)-Human sperm mitochondria-associated cysteine-rich protein (SMCP), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.