DNAJC5B (NM_033105) Human Tagged ORF Clone

SKU
RG205251
DNAJC5B (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJC5B
Synonyms CSP-beta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205251 representing NM_033105
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATGTAACATACCTAACCAAAGACAGCGGACTCTGTCAACAACAGGAGAAGCTCTATACGAAATTC
TTGGTCTGCATAAGGGAGCATCAAATGAAGAAATTAAGAAAACCTACAGAAAATTGGCCCTGAAACACCA
TCCAGACAAGAATCCAGATGATCCAGCTGCTACTGAGAAGTTTAAAGAAATCAACAACGCCCACGCAATA
CTTACCGACATTTCAAAGAGAAGCATATACGACAAGTACGGATCGCTGGGACTCTACGTGGCCGAGCAGT
TTGGAGACGAAAACGTTAACACCTACTTCATGCTGTCGAGCTGGTGGGCAAAGGCCCTGTTTGTCATCGT
TGGCCTCTTGACGGGCTGCTACTTTTGCTGCTGCCTGTGCTGCTGCTGCAACTGCTGCTGTGGACACTGC
CGGCCCGAGTCATCAGTGCCAGAAGAGGACTTCTATGTGTCCCCAGAGGATCTGGAGGAGCAGATCAAGT
CTGACATGGAAAAAGATGTGGACTTTCCAGTTTTTCTCCAGCCTACAAATGCAAATGAGAAAACACAGCT
AATCAAAGAAGGATCTCGAAGTTATTGCACAGACTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205251 representing NM_033105
Red=Cloning site Green=Tags(s)

MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI
LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC
RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033105
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033105.6
RefSeq Size 1398 bp
RefSeq ORF 600 bp
Locus ID 85479
UniProt ID Q9UF47
Cytogenetics 8q13.1
Summary This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:DNAJC5B (NM_033105) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205251 DNAJC5B (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) 10 ug
$300.00
RC205251L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), Myc-DDK-tagged 10 ug
$600.00
RC205251L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), mGFP tagged 10 ug
$600.00
RC205251L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), Myc-DDK-tagged 10 ug
$600.00
RC205251L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), mGFP tagged 10 ug
$600.00
SC101670 DNAJC5B (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.