SH2D1B (NM_053282) Human Tagged ORF Clone

SKU
RG205069
SH2D1B (tGFP-tagged) - Human SH2 domain containing 1B (SH2D1B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SH2D1B
Synonyms EAT2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205069 representing NM_053282
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTGCCTTACTACCATGGACGTCTGACCAAGCAAGACTGTGAGACCTTGCTGCTCAAGGAAGGGG
TGGATGGCAACTTTCTTTTAAGAGACAGCGAGTCGATACCAGGAGTCCTGTGCCTCTGTGTCTCGTTTAA
AAATATTGTCTACACATACCGAATCTTCAGAGAGAAACACGGGTATTACAGGATACAGACTGCAGAAGGT
TCTCCAAAACAGGTCTTTCCAAGCCTAAAGGAACTGATCTCCAAATTTGAAAAACCAAATCAGGGGATGG
TGGTTCACCTTTTAAAGCCAATAAAGAGAACCAGCCCCAGCTTGAGATGGAGAGGATTGAAATTAGAGTT
GGAAACATTTGTGAACAGTAACAGCGATTATGTGGATGTCTTGCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205069 representing NM_053282
Red=Cloning site Green=Tags(s)

MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG
SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_053282
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_053282.5
RefSeq Size 2553 bp
RefSeq ORF 399 bp
Locus ID 117157
UniProt ID O14796
Cytogenetics 1q23.3
Protein Pathways Natural killer cell mediated cytotoxicity
Summary By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:SH2D1B (NM_053282) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205069 SH2D1B (Myc-DDK-tagged)-Human SH2 domain containing 1B (SH2D1B) 10 ug
$150.00
RC205069L3 Lenti ORF clone of Human SH2 domain containing 1B (SH2D1B), Myc-DDK-tagged 10 ug
$450.00
RC205069L4 Lenti ORF clone of Human SH2 domain containing 1B (SH2D1B), mGFP tagged 10 ug
$450.00
SC125856 SH2D1B (untagged)-Human SH2 domain containing 1B (SH2D1B) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.