SLIRP (NM_031210) Human Tagged ORF Clone

SKU
RG205002
SLIRP (tGFP-tagged) - Human chromosome 14 open reading frame 156 (C14orf156)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLIRP
Synonyms C14orf156; DC50; PD04872
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205002 representing NM_031210
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCTCAGCAGCGCGAGGTGCTGCGGCGCTGCGTAGAAGTATCAATCAGCCGGTTGCTTTTGTGA
GAAGAATTCCTTGGACTGCGGCGTCGAGTCAGCTGAAAGAACACTTTGCACAGTTCGGCCATGTCAGAAG
GTGCATTTTACCTTTTGACAAGGAGACTGGCTTTCACAGAGGTTTGGGTTGGGTTCAGTTTTCTTCAGAA
GAAGGACTTCGGAATGCACTACAACAGGAAAATCATATTATAGATGGAGTAAAGGTCCAGGTTCACACTA
GAAGGCCAAAACTTCCGCAAACATCTGATGATGAAAAGAAAGATTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205002 representing NM_031210
Red=Cloning site Green=Tags(s)

MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE
EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031210
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031210.3, NP_112487.1
RefSeq Size 399 bp
RefSeq ORF 330 bp
Locus ID 81892
UniProt ID Q9GZT3
Cytogenetics 14q24.3
Domains RRM
Summary Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:SLIRP (NM_031210) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205002 SLIRP (Myc-DDK-tagged)-Human chromosome 14 open reading frame 156 (C14orf156) 10 ug
$150.00
RC205002L1 Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), Myc-DDK-tagged 10 ug
$450.00
RC205002L2 Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), mGFP tagged 10 ug
$450.00
RC205002L3 Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), Myc-DDK-tagged 10 ug
$450.00
RC205002L4 Lenti ORF clone of Human chromosome 14 open reading frame 156 (C14orf156), mGFP tagged 10 ug
$450.00
SC108657 SLIRP (untagged)-Human chromosome 14 open reading frame 156 (C14orf156) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.