ATP5PO (NM_001697) Human Tagged ORF Clone

SKU
RG204991
ATP5O (tGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ATP5PO
Synonyms ATP5O; ATPO; HMC08D05; OSCP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204991 representing NM_001697
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCCCAGCAGTGTCCGGGCTCTCCCGGCAGGTGCGATGCTTCAGTACCTCTGTGGTCAGACCAT
TTGCCAAGCTTGTGAGGCCTCCTGTTCAGGTATACGGTATTGAAGGTCGCTATGCCACAGCTCTTTATTC
TGCTGCATCAAAACAGAATAAGCTGGAGCAAGTAGAAAAGGAGTTGTTGAGAGTAGCACAAATCCTGAAG
GAACCCAAAGTGGCTGCTTCTGTTTTGAATCCCTATGTGAAGCGTTCCATTAAAGTGAAAAGCCTAAATG
ACATCACAGCAAAAGAGAGGTTCTCTCCCCTCACTACCAACCTGATCAATTTGCTTGCTGAAAATGGTCG
ATTAAGCAATACCCAAGGAGTCGTTTCTGCCTTTTCTACCATGATGAGTGTCCATCGCGGAGAGGTACCT
TGCACAGTGACCTCTGCATCTCCTTTAGAAGAAGCCACACTCTCTGAATTAAAAACTGTCCTCAAGAGCT
TCCTAAGTCAAGGCCAAGTATTGAAATTGGAGGCTAAGACTGATCCGTCAATCTTGGGTGGAATGATTGT
GCGCATTGGCGAGAAATATGTTGACATGTCTGTCAAGACCAAGATTCAGAAGCTGGGCAGGGCTATGCGG
GAGATTGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204991 representing NM_001697
Red=Cloning site Green=Tags(s)

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR
EIV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001697
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001697.1
RefSeq Size 815 bp
RefSeq ORF 642 bp
Locus ID 539
UniProt ID P48047
Cytogenetics 21q22.11
Domains OSCP
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Summary The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ATP5PO (NM_001697) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204991 ATP5O (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC204991L1 Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC204991L2 Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC204991L3 Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC204991L4 Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC119088 ATP5O (untagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.